Orthogonal Strategies: Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining in human prostate and skeletal muscle tissues using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are ...read more
Orthogonal Strategies: Western Blot: ALDH1A3 Antibody [NBP1-91657] - Analysis in human cell lines A-431 and Caco-2 using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human prostate shows high expression.
Immunohistochemistry-Frozen: ALDH1A3 Antibody [NBP1-91657] - Aldh1a3 expression on E11.5 mouse embryo eye. Heat induced antigen retrieval at pH 6.0 was done for 20 minutes with mouse E11.5 coronal cryosection. Image ...read more
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Cell proliferation during the oestrus cycle.(a) Protocol: adult (≥10-week-old) C57Bl6/J mice were administered CldU during pro-oestrus/early ...read more
Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Orthogonal Strategies: Analysis in human prostate and skeletal muscle tissues using NBP1-91657 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same tissues.
Staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Novus Biologicals Rabbit ALDH1A3 Antibody - BSA Free (NBP1-91657) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ALDH1A3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH1A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunohistochemistry-Frozen Validated from a verified customer review
Immunohistochemistry-Paraffin 1:20-1:50
Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Theoretical MW
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Rat (83%). Mouse reactivity reported in scientific literature (PMID: 26511661).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for ALDH1A3 Antibody - BSA Free
aldehyde dehydrogenase 1 family, member A3
Aldehyde Dehydrogenase 1-A3
Aldehyde dehydrogenase 6
aldehyde dehydrogenase family 1 member A3
ALDH1A3
ALDH1A6
ALDH6
ALDH6acetaldehyde dehydrogenase 6
EC 1.2.1
EC 1.2.1.5
MCOP8
RALDH3
RALDH-3
Retinaldehyde dehydrogenase 3
Background
Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The enzyme encoded by this gene uses retinal as a substrate, either in a free or cellular retinol-binding protein form. [provided by RefSeq].
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.