ALDH16A1 Antibody

Images

 
Western Blot: ALDH16A1 Antibody [NBP2-31774] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ALDH16A1 Antibody [NBP2-31774] - Immunofluorescent staining of human cell line A549 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ALDH16A1 Antibody [NBP2-31774] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH16A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH16A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALDH16A1 Protein (NBP2-31774PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH16A1 Antibody

  • aldehyde dehydrogenase 16 family, member A1
  • aldehyde dehydrogenase family 16 member A1
  • MGC10204

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-15339
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALDH16A1 Antibody (NBP2-31774) (0)

There are no publications for ALDH16A1 Antibody (NBP2-31774).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH16A1 Antibody (NBP2-31774) (0)

There are no reviews for ALDH16A1 Antibody (NBP2-31774). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALDH16A1 Antibody (NBP2-31774) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH16A1 Products

Bioinformatics Tool for ALDH16A1 Antibody (NBP2-31774)

Discover related pathways, diseases and genes to ALDH16A1 Antibody (NBP2-31774). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH16A1 Antibody (NBP2-31774)

Discover more about diseases related to ALDH16A1 Antibody (NBP2-31774).
 

Pathways for ALDH16A1 Antibody (NBP2-31774)

View related products by pathway.

Research Areas for ALDH16A1 Antibody (NBP2-31774)

Find related products by research area.

Blogs on ALDH16A1

There are no specific blogs for ALDH16A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH16A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH16A1
Uniprot