Aldehyde Dehydrogenase 1-A1/ALDH1A1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Aldehyde Dehydrogenase 1-A1/ALDH1A1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH1A1.
  
  

  Source: E. coli

  Amino Acid Sequence: IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ALDH1A1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89152.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Recombinant Protein Antigen

• acetaldehyde dehydrogenase 1
• ALDC
• aldehyde dehydrogenase 1 family, member A1
• aldehyde dehydrogenase 1, soluble
• Aldehyde Dehydrogenase 1A1
• Aldehyde Dehydrogenase 1-A1
• Aldehyde dehydrogenase family 1 member A1
• Aldehyde dehydrogenase, cytosolic
• aldehyde dehydrogenase, liver cytosolic
• ALDH class 1
• ALDH1
• ALDH11
• ALDH1A1
• ALDH-E1
• ALHDII
• EC 1.2.1
• EC 1.2.1.36
• MGC2318
• PUMB1
• RALDH 1
• RALDH1
• retinal dehydrogenase 1
• retinaldehyde dehydrogenase 1

Background

Usual human livers contain two major ALDH isozymes, i.e., cytosolic ALDH1 and mitochondrial ALDH2(1). Human red cell aldehyde dehydrogenase (ALDH) resembles the liver cytosolic isozyme in numerous physicochemical properties. Thus, the erythrocyte enzyme, by virtue of its chemical and structural identity with the liver cytosolic enzyme, may serve as a suitable peripheral enzyme model to understand the cause and mechanism of alcohol abuse-related changes in liver cytosolic ALDH that has been found to be reduced in alcoholics (2). ALDH1A1 is known to catalyze the oxidation of retinaldehyde to retinoic acid. Overexpression of human ALDH1A1 in HEK cells led to a more than 20-fold increase in 3-deoxyglucosone dehydrogenase activity (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ALDH1A1