Aldehyde Dehydrogenase 1-A1/ALDH1A1 Recombinant Protein Antigen

Images

 
There are currently no images for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aldehyde Dehydrogenase 1-A1/ALDH1A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH1A1.

Source: E. coli

Amino Acid Sequence: IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH1A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89152. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Recombinant Protein Antigen

  • acetaldehyde dehydrogenase 1
  • ALDC
  • aldehyde dehydrogenase 1 family, member A1
  • aldehyde dehydrogenase 1, soluble
  • Aldehyde Dehydrogenase 1A1
  • Aldehyde Dehydrogenase 1-A1
  • Aldehyde dehydrogenase family 1 member A1
  • Aldehyde dehydrogenase, cytosolic
  • aldehyde dehydrogenase, liver cytosolic
  • ALDH class 1
  • ALDH1
  • ALDH11
  • ALDH1A1
  • ALDH-E1
  • ALHDII
  • EC 1.2.1
  • EC 1.2.1.36
  • MGC2318
  • PUMB1
  • RALDH 1
  • RALDH1
  • retinal dehydrogenase 1
  • retinaldehyde dehydrogenase 1

Background

Usual human livers contain two major ALDH isozymes, i.e., cytosolic ALDH1 and mitochondrial ALDH2(1). Human red cell aldehyde dehydrogenase (ALDH) resembles the liver cytosolic isozyme in numerous physicochemical properties. Thus, the erythrocyte enzyme, by virtue of its chemical and structural identity with the liver cytosolic enzyme, may serve as a suitable peripheral enzyme model to understand the cause and mechanism of alcohol abuse-related changes in liver cytosolic ALDH that has been found to be reduced in alcoholics (2). ALDH1A1 is known to catalyze the oxidation of retinaldehyde to retinoic acid. Overexpression of human ALDH1A1 in HEK cells led to a more than 20-fold increase in 3-deoxyglucosone dehydrogenase activity (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37397
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87158
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP2-15339
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-02483
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-16627
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF5247
Species: Hu
Applications: IHC, WB
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
1129-ER
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP) (0)

There are no publications for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP) (0)

There are no reviews for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aldehyde Dehydrogenase 1-A1/ALDH1A1 Products

Research Areas for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP)

Find related products by research area.

Blogs on Aldehyde Dehydrogenase 1-A1/ALDH1A1

There are no specific blogs for Aldehyde Dehydrogenase 1-A1/ALDH1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aldehyde Dehydrogenase 1-A1/ALDH1A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH1A1