Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (1G6) Summary
Immunogen |
ALDH1A1 (AAH01505, 1 a.a. ~ 501 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS |
Marker |
Astrocyte Marker |
Specificity |
ALDH1A1 - aldehyde dehydrogenase 1 family, member A1 (1G6) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ALDH1A1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Immunoprecipitation
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (1G6)
Background
This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05) (0)
There are no publications for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05) (0)
There are no reviews for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Aldehyde Dehydrogenase 1-A1/ALDH1A1 Products
Bioinformatics Tool for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05)
Discover related pathways, diseases and genes to Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05)
Discover more about diseases related to Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05).
| | Pathways for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05)
View related products by pathway.
|
PTMs for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05)
Learn more about PTMs related to Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05).
| | Research Areas for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (H00000216-M05)
Find related products by research area.
|
Blogs on Aldehyde Dehydrogenase 1-A1/ALDH1A1