We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

alcohol dehydrogenase 7 Recombinant Protein Antigen

Images

 
There are currently no images for alcohol dehydrogenase 7 Protein (NBP1-90232PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

alcohol dehydrogenase 7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADH7.

Source: E. coli

Amino Acid Sequence: KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADH7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90232.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alcohol dehydrogenase 7 Recombinant Protein Antigen

  • ADH4
  • ADH-4
  • alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  • alcohol dehydrogenase class 4 mu/sigma chain
  • Alcohol dehydrogenase class IV mu/sigma chain
  • alcohol dehydrogenase VII
  • alcohol dehydrogenase-7
  • class IV sigma-1 alcohol dehydrogenase
  • class IV sigmasigma alcohol dehydrogenase
  • EC 1.1.1
  • EC 1.1.1.1
  • Gastric alcohol dehydrogenase
  • Retinol dehydrogenase

Background

alcohol dehydrogenase 7 encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-69822
Species: Hu
Applications: ELISA
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-35880
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-49350
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-00637
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-37397
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF5869
Species: Hu, Mu
Applications: ICC, IHC, IP, Simple Western, WB
NBP2-30446
Species: Hu
Applications: ICC/IF,  IHC-P
NBP1-52047
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP2-62658
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-87158
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP3-46767
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
H00145226-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-83790
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90232PEP
Species: Hu
Applications: AC

Publications for alcohol dehydrogenase 7 Protein (NBP1-90232PEP) (0)

There are no publications for alcohol dehydrogenase 7 Protein (NBP1-90232PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 7 Protein (NBP1-90232PEP) (0)

There are no reviews for alcohol dehydrogenase 7 Protein (NBP1-90232PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alcohol dehydrogenase 7 Protein (NBP1-90232PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alcohol dehydrogenase 7 Products

Blogs on alcohol dehydrogenase 7

There are no specific blogs for alcohol dehydrogenase 7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alcohol dehydrogenase 7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH7