Recombinant Human alcohol dehydrogenase 6 Protein

Images

 
SDS-Page: Recombinant Human alcohol dehydrogenase 6 Protein [H00000130-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human alcohol dehydrogenase 6 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human ADH6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GSKHLDLLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNT

Protein/Peptide Type
Partial Recombinant Protein
Gene
ADH6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alcohol dehydrogenase 6 Protein

  • ADH-5
  • alcohol dehydrogenase 6 (class V)
  • alcohol dehydrogenase 6
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Background

ADH6 - alcohol dehydrogenase 6 (class V)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-55039
Species: Hu
Applications: WB
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32828
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC

Publications for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01) (0)

There are no publications for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01) (0)

There are no reviews for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alcohol dehydrogenase 6 Products

Bioinformatics Tool for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01)

Discover related pathways, diseases and genes to alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01)

Discover more about diseases related to alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01).
 

Pathways for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01)

View related products by pathway.

PTMs for alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01)

Learn more about PTMs related to alcohol dehydrogenase 6 Partial Recombinant Protein (H00000130-Q01).

Blogs on alcohol dehydrogenase 6

There are no specific blogs for alcohol dehydrogenase 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alcohol dehydrogenase 6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH6