alcohol dehydrogenase 5 Antibody - BSA Free

Immunohistochemistry-Paraffin: alcohol dehydrogenase 5 Antibody [NBP2-30636] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alcohol dehydrogenase 5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADH5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot
• Application Notes: Use in Western Blot reported in scientific literature (PMID:29074597).For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  alcohol dehydrogenase 5 Protein (NBP2-30636PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:29074597).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alcohol dehydrogenase 5 Antibody - BSA Free

• ADH-3
• ADHXEC 1.1.1.1
• alcohol dehydrogenase (class III), chi polypeptide
• alcohol dehydrogenase 5 (class III), chi polypeptide
• Alcohol dehydrogenase 5
• Alcohol dehydrogenase class chi chain
• alcohol dehydrogenase class-3
• Alcohol dehydrogenase class-III
• EC 1.1.1
• EC 1.1.1.-
• EC 1.1.1.284
• FALDH
• FDHGSNOR
• formaldehyde dehydrogenase
• Glutathione-dependent formaldehyde dehydrogenase
• GSH-FDH
• S-(hydroxymethyl)glutathione dehydrogenase

Background

The ADH5 gene encodes glutathione dependent formaldehyde dehydrogenase or class III alcohol dehydrogenase chi subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, retinol, ethanol and other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class III alcohol dehydrogenase is a homodimer composed of 2 chi subunits. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long chain primary alcohols and for oxidation of S hydroxymethyl glutathione, a spontaneous adduct between formaldehyde and glutathione. The enzyme is an important component of cellular metabolism for the elimination of formaldehyde, which is a potent irritant and sensitizing agent that causes rhinitis, lacrymation, contact dermatitis and pharyngitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alcohol dehydrogenase 5 Antibody (NBP2-30636)(1)

Publication using NBP2-30636

• Qian Q, Zhang Z, Orwig A et al. S-Nitrosoglutathione Reductase Dysfunction Contributes to Obesity-Associated Hepatic Insulin Resistance via Regulating Autophagy Diabetes 2017-10-26 [PMID: 29074597] (WB, Mouse)

Review for alcohol dehydrogenase 5 Antibody (NBP2-30636) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 09/25/2020

Summary

• Application: Western Blot
• Sample Tested: Liver
• Species: Mouse
• Lot: AM

Bioinformatics

• Gene Symbol: ADH5
• Uniprot:
  • P11766(Human)