Alanyl tRNA synthetase Antibody

Images

 
Western Blot: Alanyl tRNA synthetase Antibody [NBP1-87414] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: Alanyl tRNA synthetase Antibody [NBP1-87414] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: Alanyl tRNA synthetase Antibody [NBP1-87414] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Alanyl tRNA synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DRASKADVQKRVLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Alanyl tRNA synthetase Recombinant Protein Antigen (NBP1-87414PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Alanyl tRNA synthetase Antibody

  • alanine tRNA ligase 1, cytoplasmic
  • Alanine--tRNA ligase
  • alanyl-tRNA synthetase
  • alanyl-tRNA synthetase, cytoplasmic
  • alaRS
  • CMT2N
  • EC 6.1.1
  • EC 6.1.1.7
  • Renal carcinoma antigen NY-REN-42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38035
Species: Hu
Applications: IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56415
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP1-54653
Species: Hu
Applications: WB
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-87414
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Alanyl tRNA synthetase Antibody (NBP1-87414) (0)

There are no publications for Alanyl tRNA synthetase Antibody (NBP1-87414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alanyl tRNA synthetase Antibody (NBP1-87414) (0)

There are no reviews for Alanyl tRNA synthetase Antibody (NBP1-87414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alanyl tRNA synthetase Antibody (NBP1-87414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alanyl tRNA synthetase Products

Bioinformatics Tool for Alanyl tRNA synthetase Antibody (NBP1-87414)

Discover related pathways, diseases and genes to Alanyl tRNA synthetase Antibody (NBP1-87414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alanyl tRNA synthetase Antibody (NBP1-87414)

Discover more about diseases related to Alanyl tRNA synthetase Antibody (NBP1-87414).
 

Pathways for Alanyl tRNA synthetase Antibody (NBP1-87414)

View related products by pathway.

PTMs for Alanyl tRNA synthetase Antibody (NBP1-87414)

Learn more about PTMs related to Alanyl tRNA synthetase Antibody (NBP1-87414).

Blogs on Alanyl tRNA synthetase

There are no specific blogs for Alanyl tRNA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alanyl tRNA synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AARS
Entrez
Uniprot