| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 100-189 of Human AKT2 Source: Wheat Germ (in vitro) Amino Acid Sequence: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | AKT2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 35.53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for AKT2 Partial Recombinant Protein (H00000208-Q01)Find related products by research area.
|
|
AKT Antibody Assays: A Complex Area with an Easy Solution We at Novus Biologicals place a lot of emphasis on the kinase signaling pathways. Kinases, or phosphotransferase enzymes play a key role in phosphorylation signaling. Over 500 human protein kinases have so far been discovered. They play essential role... Read full blog post. |
|
The Akt Antibody Plays Many Roles in Cancer Research There are three human isoforms of the AKT gene, which plays a key role in several signalling pathways. Akt antibody studies have shown the Atk kinases to play a diverse number of roles within the cell, regulating angiogenesis, apoptosis, protein synth... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AKT2 |