AKR1D1 Antibody (1A6)

Images

 
Western Blot: AKR1D1 Antibody (1A6) [H00006718-M01] - Analysis of AKR1D1 expression in transfected 293T cell line by AKR1D1 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1D1 transfected lysate(37.4 KDa).Lane 2: ...read more
Immunoprecipitation: AKR1D1 Antibody (1A6) [H00006718-M01] - Analysis of AKR1D1 transfected lysate using anti-AKR1D1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKR1D1 MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AKR1D1 Antibody (1A6) Summary

Immunogen
AKR1D1 (NP_005980, 227 a.a. - 326 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKR1D1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKR1D1 Antibody (1A6)

  • 3o5bred
  • Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase
  • aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase)
  • CBAS2
  • Delta(4)-3-oxosteroid 5-beta-reductase
  • EC 1.3.1.3
  • SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1)

Background

The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6529
Species: Hu
Applications: WB, Simple Western
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF-252-PB
Species: Hu
Applications: WB
640-A3
Species: Mu
NBP1-56928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-06188
Species: Hu
NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1491
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91831
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3397
Species: Hu, Mu, Rt
Applications: WB
H00006718-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for AKR1D1 Antibody (H00006718-M01) (0)

There are no publications for AKR1D1 Antibody (H00006718-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR1D1 Antibody (H00006718-M01) (0)

There are no reviews for AKR1D1 Antibody (H00006718-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKR1D1 Antibody (H00006718-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKR1D1 Products

Bioinformatics Tool for AKR1D1 Antibody (H00006718-M01)

Discover related pathways, diseases and genes to AKR1D1 Antibody (H00006718-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR1D1 Antibody (H00006718-M01)

Discover more about diseases related to AKR1D1 Antibody (H00006718-M01).
 

Pathways for AKR1D1 Antibody (H00006718-M01)

View related products by pathway.

PTMs for AKR1D1 Antibody (H00006718-M01)

Learn more about PTMs related to AKR1D1 Antibody (H00006718-M01).

Blogs on AKR1D1

There are no specific blogs for AKR1D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKR1D1 Antibody (1A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1D1
Uniprot