Akirin2 Antibody - BSA Free

Western Blot: Akirin2 Antibody [NBP3-10695] - Western blot analysis of Akirin2 in Mouse Spleen lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Akirin2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Akirin2 (NP_001007590). Peptide sequence CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKIRIN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Akirin2 Antibody - BSA Free

• akirin 2
• akirin-2
• C6orf166
• chromosome 6 open reading frame 166
• dJ486L4.2
• FBI1
• FLJ10342
• fourteen-three-three beta interactant 1

Background

Akirin2 is required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to represstranscription of DUSP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKIRIN2