AKAP9 Antibody - BSA Free

Western Blot: AKAP9 Antibody [NBP1-80308] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

AKAP9 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human AKAP9. Peptide sequence MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKAP9
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for AKAP9 Antibody - BSA Free

• A kinase (PRKA) anchor protein (yotiao) 9
• AKAP 350
• AKAP 450
• AKAP350A-kinase anchor protein 450 kDa
• AKAP450A-kinase anchor protein 350 kDa
• AKAP-9
• Centrosome- and Golgi-localized PKN-associated protein
• CG-NAPAKAP 120-like protein
• hgAKAP 350
• HYPERION
• KIAA0803A-kinase anchor protein 9
• MU-RMS-40.16A
• PRKA9AKAP9-BRAF fusion protein
• Protein hyperion
• protein kinase A anchoring protein 9
• Protein kinase A-anchoring protein 9
• Protein yotiao
• YOTIAOkinase N-associated protein

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in many isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKAP9
• Uniprot:
  • AAH15533(Human)