Recombinant Human AK3 Protein

Product Discontinued

Recombinant Human AK3 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-227 of Human AK3 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: AK3

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AK3 Protein

• Adenylate kinase 3 alpha-like 1
• adenylate kinase 3 like 1
• Adenylate kinase 3
• adenylate kinase 3adenylate kinase 6
• AK 3
• AK3
• AK3L1
• AK6
• AKL3L
• AKL3L1
• EC 2.7.4
• EC 2.7.4.10
• FIX
• GTP:AMP phosphotransferase, mitochondrial

Background

Adenylate kinase (AK; adenosine triphosphate-adenosine monophosphate [ATP-AMP] phospho-transferase, EC 2.7.4.3) is a ubiquitous monomeric enzyme involved energy metabolism of prokaryotic and eukaryotic cells. Three isozymes (AK1, AK2 and AK3) are characterized in vertebrates. AK1 is present in the cytosol of skeletal muscle, brain, and erythrocyte, while AK2 is localized in the intermembrane space of mitochondria of liver, kidney, spleen and heart. AK3, called GTP:AMP phosphotransferase, exists in the mitochondrial matrix of liver and heart. These isozymes contribute to homeostasis of the adenine nucleotide composition in the cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: AK3