AK2 Antibody

Images

 
Western Blot: AK2 Antibody [H00000204-D01P] - Analysis of AK2 expression in mouse kidney.
Western Blot: AK2 Antibody [H00000204-D01P] - Analysis of AK2 expression in human kidney.
Western Blot: AK2 Antibody [H00000204-D01P] - Analysis of AK2 expression in transfected 293T cell line by AK2 polyclonal antibody.Lane 1: AK2 transfected lysate(26.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AK2 Antibody Summary

Immunogen
AK2 (NP_001616.1, 1 a.a. - 239 a.a.) full-length human protein. MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AK2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AK2 Antibody

  • adenylate kinase 2
  • adenylate kinase 2, mitochondrial
  • adenylate kinase isoenzyme 2, mitochondrial
  • ADK2
  • AK 2
  • ATP-AMP transphosphorylase 2
  • EC 2.7.4
  • EC 2.7.4.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00827
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-02978
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA

Publications for AK2 Antibody (H00000204-D01P) (0)

There are no publications for AK2 Antibody (H00000204-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AK2 Antibody (H00000204-D01P) (0)

There are no reviews for AK2 Antibody (H00000204-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AK2 Antibody (H00000204-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AK2 Products

Bioinformatics Tool for AK2 Antibody (H00000204-D01P)

Discover related pathways, diseases and genes to AK2 Antibody (H00000204-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AK2 Antibody (H00000204-D01P)

Discover more about diseases related to AK2 Antibody (H00000204-D01P).
 

Pathways for AK2 Antibody (H00000204-D01P)

View related products by pathway.

PTMs for AK2 Antibody (H00000204-D01P)

Learn more about PTMs related to AK2 Antibody (H00000204-D01P).

Blogs on AK2

There are no specific blogs for AK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AK2
Uniprot