AIP/ARA9 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AIP/ARA9 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AIP/ARA9.

  Source: E. coli

  Amino Acid Sequence: MTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AIP
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55628.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AIP/ARA9 Recombinant Protein Antigen

• ARA9
• FKBP16
• FKBP37
• SMTPHN
• XAP2
• XAP-2

Background

Aryl-hydrocarbon receptor-interacting protein immunophilin homolog ARA9, also known as AIP and XAP-2, is known to affect the potency and efficacy of AHR agonists and have functional consequences on AHR signal transduction. ARA9 may also play a positive role in AHR-mediated signaling, by influencing its ligand receptivity and/or nuclear targeting ability. Defects in AIP can lead to familial isolated pituitary adenoma (FIPA), growth hormone-secreting pituitary adenoma (GHSPA), ACTH-secreting pituitary adenoma (ASPA), and prolactin-secreting pituitary adenoma (PSPA).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: AIP