Recombinant Human AIMP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AIMP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human JTV1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT

Protein/Peptide Type
Partial Recombinant Protein
Gene
AIMP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AIMP2 Protein

  • aminoacyl tRNA synthase complex-interacting multifunctional protein 2
  • aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
  • ARS-interacting multi-functional protein 2
  • JTV1JTV-1
  • Multisynthase complex auxiliary component p38
  • multisynthetase complex auxiliary component p38
  • P38
  • PRO0992
  • Protein JTV-1

Background

The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
H00007965-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for AIMP2 Partial Recombinant Protein (H00007965-Q01) (0)

There are no publications for AIMP2 Partial Recombinant Protein (H00007965-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIMP2 Partial Recombinant Protein (H00007965-Q01) (0)

There are no reviews for AIMP2 Partial Recombinant Protein (H00007965-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AIMP2 Partial Recombinant Protein (H00007965-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AIMP2 Products

Bioinformatics Tool for AIMP2 Partial Recombinant Protein (H00007965-Q01)

Discover related pathways, diseases and genes to AIMP2 Partial Recombinant Protein (H00007965-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIMP2 Partial Recombinant Protein (H00007965-Q01)

Discover more about diseases related to AIMP2 Partial Recombinant Protein (H00007965-Q01).
 

Pathways for AIMP2 Partial Recombinant Protein (H00007965-Q01)

View related products by pathway.

PTMs for AIMP2 Partial Recombinant Protein (H00007965-Q01)

Learn more about PTMs related to AIMP2 Partial Recombinant Protein (H00007965-Q01).

Blogs on AIMP2

There are no specific blogs for AIMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AIMP2 Antibody
NBP1-81575

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AIMP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AIMP2