We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

AIBZIP Recombinant Protein Antigen

Images

 
There are currently no images for AIBZIP Protein (NBP1-90205PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AIBZIP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CREB3L4.

Source: E. coli

Amino Acid Sequence: ELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CREB3L4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90205.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AIBZIP Recombinant Protein Antigen

  • AIbZIP
  • AIBZIPcAMP-responsive element-binding protein 4
  • Androgen-induced basic leucine zipper protein
  • ATCE1JAL
  • Attaching to CRE-like 1
  • cAMP responsive element binding protein 1
  • cAMP responsive element binding protein 3-like 4
  • CREB3
  • CREB4CREB-4
  • cyclic AMP-responsive element-binding protein 3-like protein 4
  • Cyclic AMP-responsive element-binding protein 4
  • hJALcAMP-responsive element-binding protein 3-like protein 4
  • tisp40
  • Transcript induced in spermiogenesis protein 40

Background

Androgen-induced basic leucine zipper (AIBZIP)is a transcription factor. AIbZIP is a 395 aa protein with homology to cyclic AMP-responsive element binding protein/activating transcription factor. It contains an NH(2)-terminal activation domain, a central bZIP domain, and a COOH-terminal transmembrane domain. Immunoreactive AIbZIP protein has been detected in the cytoplasm of prostatic luminal epithelial cells; full-length AIbZIP-GFP fusion proteins are localized in the cytoplasm of LNCaP cells, while a truncated form of AIbZIP lacking the putative transmembrane domain was exclusively nuclear. AIbZIP is expressed at higher levels in cancerous prostate cells compared with noncancerous prostate cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-68209
Species: Hu
Applications: IP, KD, WB
NBP1-90364
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NBP2-13873
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NBP1-82503
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
212-GD
Species: Hu
Applications: Bind, BA
NBP1-88697
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NB100-65887
Species: Hu
Applications: Flow, IP
NBP3-09042
Species: Hu
Applications: Flow, ICC/IF
1310-SE
Species: Hu
Applications: EnzAct
H00001390-M02
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP2-94859
Species: Hu, Mu, Rt
Applications: WB
NBP2-38747
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21584
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB363
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NBP1-90205PEP
Species: Hu
Applications: AC

Publications for AIBZIP Protein (NBP1-90205PEP) (0)

There are no publications for AIBZIP Protein (NBP1-90205PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIBZIP Protein (NBP1-90205PEP) (0)

There are no reviews for AIBZIP Protein (NBP1-90205PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AIBZIP Protein (NBP1-90205PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AIBZIP Products

Research Areas for AIBZIP Protein (NBP1-90205PEP)

Find related products by research area.

Blogs on AIBZIP

There are no specific blogs for AIBZIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AIBZIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB3L4