AIBZIP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CREB3L4. Source: E. coli
Amino Acid Sequence: ELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CREB3L4 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90205. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for AIBZIP Recombinant Protein Antigen
Background
Androgen-induced basic leucine zipper (AIBZIP)is a transcription factor. AIbZIP is a 395 aa protein with homology to cyclic AMP-responsive element binding protein/activating transcription factor. It contains an NH(2)-terminal activation domain, a central bZIP domain, and a COOH-terminal transmembrane domain. Immunoreactive AIbZIP protein has been detected in the cytoplasm of prostatic luminal epithelial cells; full-length AIbZIP-GFP fusion proteins are localized in the cytoplasm of LNCaP cells, while a truncated form of AIbZIP lacking the putative transmembrane domain was exclusively nuclear. AIbZIP is expressed at higher levels in cancerous prostate cells compared with noncancerous prostate cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu
Applications: Bind, BA
Species: Hu, Mu, Xp
Applications: ChIP, IHC, IHC-P, WB
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: AC
Publications for AIBZIP Protein (NBP1-90205PEP) (0)
There are no publications for AIBZIP Protein (NBP1-90205PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AIBZIP Protein (NBP1-90205PEP) (0)
There are no reviews for AIBZIP Protein (NBP1-90205PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for AIBZIP Protein (NBP1-90205PEP) (0)
Additional AIBZIP Products
Research Areas for AIBZIP Protein (NBP1-90205PEP)
Find related products by research area.
|
Blogs on AIBZIP