AGXT2 Antibody

Images

 
Western Blot: AGXT2 Antibody [NBP1-79303] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGXT2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human AGXT2The immunogen for this antibody is AGXT2. Peptide sequence TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGXT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Publications
Read Publication using
NBP1-79303 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:32994511)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AGXT2 Antibody

  • (R)-3-amino-2-methylpropionate--pyruvate transaminase
  • AGT 2
  • alanine-glyoxylate aminotransferase 2
  • alanine--glyoxylate aminotransferase 2
  • Beta-ALAAT II
  • Beta-alanine-pyruvate aminotransferase
  • DAIBAT
  • D-AIBAT
  • EC 2.6.1.40
  • EC 2.6.1.44
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89200
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-79286
Species: Rt
Applications: WB
NBP3-10159
Species: Rt
Applications: WB
NBP2-54724
Species: Hu
Applications: IHC, IHC-P, WB
NB100-62346
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-84268
Species: Hu
Applications: WB
NBP2-59311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-33751
Species: Hu
Applications: IHC, IHC-P, WB
MAB2317
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-83239
Species: Bv, Hu
Applications: IHC, IHC-P, WB
NBP1-85273
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92167
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00051733-M09
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for AGXT2 Antibody (NBP1-79303)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for AGXT2 Antibody (NBP1-79303) (0)

There are no reviews for AGXT2 Antibody (NBP1-79303). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGXT2 Antibody (NBP1-79303) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AGXT2 Products

Bioinformatics Tool for AGXT2 Antibody (NBP1-79303)

Discover related pathways, diseases and genes to AGXT2 Antibody (NBP1-79303). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGXT2 Antibody (NBP1-79303)

Discover more about diseases related to AGXT2 Antibody (NBP1-79303).
 

Pathways for AGXT2 Antibody (NBP1-79303)

View related products by pathway.

PTMs for AGXT2 Antibody (NBP1-79303)

Learn more about PTMs related to AGXT2 Antibody (NBP1-79303).

Blogs on AGXT2

There are no specific blogs for AGXT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGXT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGXT2
Uniprot