AGXT2 Antibody - BSA Free

Western Blot: AGXT2 Antibody [NBP1-79303] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AGXT2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human AGXT2The immunogen for this antibody is AGXT2. Peptide sequence TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGXT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:32994511)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AGXT2 Antibody - BSA Free

• (R)-3-amino-2-methylpropionate--pyruvate transaminase
• AGT 2
• alanine-glyoxylate aminotransferase 2
• alanine--glyoxylate aminotransferase 2
• Beta-ALAAT II
• Beta-alanine-pyruvate aminotransferase
• DAIBAT
• D-AIBAT
• EC 2.6.1.40
• EC 2.6.1.44
• mitochondrial

Background

AGXT2, also known as Alanin-glyoxylate aminotransferase 2, consists of a 524 amino acid isoform that is 57 kDa, and is involved in the conversion of glyoxylate to glycine, the digestion of asymmetric dimethylarginine, and the regulation of blood pressure. Current research is being conducted on AGXT2 and its relation to mycobacterium tuberculosis and primary hyperoxaluria. This protein is included in the pathways of nucleotide and pyrimidine metabolism where it interacts with AGXT, ALAS2, GATM, GCAT, and GLDC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AGXT2 Antibody (NBP1-79303)(1)

Publication using NBP1-79303

• Jayachandran I, Sundararajan S, Venkatesan S et al. Asymmetric dimethylarginine (ADMA) accelerates renal cell fibrosis under high glucose condition through NOX4/ROS/ERK signaling pathway Sci Rep 2020-09-29 [PMID: 32994511] (WB, Rat)

Bioinformatics

• Gene Symbol: AGXT2
• Uniprot:
  • NP_114106(Human)