Recombinant Human AGPS Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AGPS Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 559-658 of Human AGPS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AGPS

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AGPS Protein

  • ADAP-S
  • ADAS
  • ADHAPSAlkylglycerone-phosphate synthase
  • ADPS
  • Aging-associated gene 5 protein
  • aging-associated protein 5
  • ALDHPSY
  • Alkyl-DHAP synthase
  • alkyldihydroxyacetonephosphate synthase, peroxisomal
  • alkylglycerone phosphate synthase
  • DKFZp762O2215
  • EC 2.5.1.26
  • FLJ99755

Background

AGPS - alkylglycerone phosphate synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008443-B01P
Species: Hu
Applications: WB, ICC/IF
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-57578
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for AGPS Partial Recombinant Protein (H00008540-Q01) (0)

There are no publications for AGPS Partial Recombinant Protein (H00008540-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGPS Partial Recombinant Protein (H00008540-Q01) (0)

There are no reviews for AGPS Partial Recombinant Protein (H00008540-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGPS Partial Recombinant Protein (H00008540-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGPS Products

Bioinformatics Tool for AGPS Partial Recombinant Protein (H00008540-Q01)

Discover related pathways, diseases and genes to AGPS Partial Recombinant Protein (H00008540-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPS Partial Recombinant Protein (H00008540-Q01)

Discover more about diseases related to AGPS Partial Recombinant Protein (H00008540-Q01).
 

Pathways for AGPS Partial Recombinant Protein (H00008540-Q01)

View related products by pathway.

Blogs on AGPS

There are no specific blogs for AGPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GM-CSF [Unconjugated]
215-GM-010/CF
AGPS Antibody
NBP1-89240

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AGPS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPS