Novus Biologicals products are now on bio-techne.com

Agpat4 Antibody

Images

 
Western Blot: Agpat4 Antibody [H00056895-B01P] - Analysis of AGPAT4 expression in transfected 293T cell line by AGPAT4 polyclonal antibody. Lane 1: AGPAT4 transfected lysate(41.58 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, PmSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Agpat4 Antibody Summary

Immunogen
AGPAT4 (NP_064518.1, 1 a.a. - 378 a.a.) full-length human protein. MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND
Specificity
AGPAT4 - 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
AGPAT4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00056895-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Agpat4 Antibody

  • 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acidacyltransferase, delta)
  • 1-AGP acyltransferase 4,1-acylglycerol-3-phosphate O-acyltransferase 4,1-AGPAT 4
  • dJ473J16.2,1-acyl-sn-glycerol-3-phosphate acyltransferase delta
  • EC 2.3.1.51
  • LPAAT-delta1-AGPAT4
  • Lysophosphatidic acid acyltransferase delta
  • lysophosphatidic acid acyltransferase-delta (LPAAT-delta)

Background

This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056894-P02
Species: Hu
Applications: ELISA, AP, PA, WB
291-G1
Species: Hu
Applications: BA
NBP2-01664
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-53125
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92662
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-87000
Species: Hu
Applications: IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-23368
Species: Hu
Applications: PAGE
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87486
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32695
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-26326
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-82826
Species: Hu
Applications: IHC, IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-76907
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-05514
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Agpat4 Antibody (H00056895-B01P)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Agpat4 Antibody (H00056895-B01P) (0)

There are no reviews for Agpat4 Antibody (H00056895-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Agpat4 Antibody (H00056895-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Agpat4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT4
Entrez
Uniprot