AGAP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: AGAP2 Antibody [NBP1-85686] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: AGAP2 Antibody [NBP1-85686] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: AGAP2 Antibody [NBP1-85686] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: AGAP2 Antibody [NBP1-85686] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: AGAP2 Antibody [NBP1-85686] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGAP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGAP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AGAP2 Protein (NBP1-85686PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AGAP2 Antibody - BSA Free

• AGAP-2
• ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
• arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
• centaurin, gamma 1
• centaurin-gamma-1
• CENTG1
• cnt-g1
• FLJ16430
• GGAP2
• GTP-binding and GTPase activating protein 2
• GTP-binding and GTPase-activating protein 2
• KIAA0167
• Phosphatidylinositol-3-kinase enhancer
• phosphoinositide 3-kinase enhancer
• PIKEArf GAP with GTP-binding protein-like, ANK repeat and PH domains 2

Background

AGAP2 (also known as centaurin-gamma1, ARF-GAP with GTP-binding protein-like, ankyrin repeat and pleckstrin homology domains 2, Phosphatidyl-inositol-3-kinase enhancer, PIKE, GTP-binding and GTPase activating protein 2 and GGAP2) is a GTPase activating protein that inactivates Arf. The expression of AGAP2 is amplified in human glioblastoma cells. AGAP2 protein binds to and activates the protein kinase Akt and prevents apoptosis of cancer cells. AGAP2 also increases motility and invasive activity of cancer cells. AGAP2 may serve as a diagnostic and therapeutic target of human cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGAP2
• Entrez:
  • 116986(Human)
• Uniprot:
  • Q99490(Human)