Afadin/AF-6 Recombinant Protein Antigen

Images

 
There are currently no images for Afadin/AF-6 Protein (NBP1-90219PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Afadin/AF-6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLLT4.

Source: E.coli

Amino Acid Sequence: ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MLLT4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90219.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Afadin/AF-6 Recombinant Protein Antigen

  • AF6
  • AF-6
  • AF64
  • AFAD
  • Afadin
  • FLJ34371
  • MLLT4
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
AF2880
Species: Hu, Mu
Applications: WB
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-90219PEP
Species: Hu
Applications: AC

Publications for Afadin/AF-6 Protein (NBP1-90219PEP) (0)

There are no publications for Afadin/AF-6 Protein (NBP1-90219PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Afadin/AF-6 Protein (NBP1-90219PEP) (0)

There are no reviews for Afadin/AF-6 Protein (NBP1-90219PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Afadin/AF-6 Protein (NBP1-90219PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Afadin/AF-6 Protein (NBP1-90219PEP)

Discover related pathways, diseases and genes to Afadin/AF-6 Protein (NBP1-90219PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Afadin/AF-6 Protein (NBP1-90219PEP)

Discover more about diseases related to Afadin/AF-6 Protein (NBP1-90219PEP).
 

Pathways for Afadin/AF-6 Protein (NBP1-90219PEP)

View related products by pathway.

PTMs for Afadin/AF-6 Protein (NBP1-90219PEP)

Learn more about PTMs related to Afadin/AF-6 Protein (NBP1-90219PEP).

Blogs on Afadin/AF-6

There are no specific blogs for Afadin/AF-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Afadin/AF-6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT4
Entrez