AEBP2 Antibody - BSA Free

Western Blot: AEBP2 Antibody [NBP2-86960] - WB Suggested Anti-Aebp2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Spleen

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AEBP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AEBP2 Antibody - BSA Free (NBP2-86960) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of AEBP2. Peptide sequence: PEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AEBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AEBP2 Antibody - BSA Free

• Adipocyte enhancer-binding protein 2
• AE binding protein 2
• AE(adipocyte enhancer)-binding protein 2
• AE-binding protein 2
• MGC17922
• zinc finger protein AEBP2

Background

DNA-binding transcriptional repressor. May interact with and stimulate the activity of the PRC2 complex,which methylates 'Lys-9' and 'Lys-27' residues of histone H3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AEBP2