CIPAR-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CIPAR-1 Antibody [NBP1-85610] - Staining of human cell line U-251 MG shows localization to nucleus, cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human kidney shows weak to moderate positivity in luminal membrane in cells in tubules.
Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIPAR-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CIPAR-1 Protein (NBP1-85610PEP)
Publications
Read Publication using NBP1-85610.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CIPAR-1 Antibody

  • Castration-induced prostatic apoptosis-related protein 1
  • CIPAR-1
  • Prostatic androgen-repressed message 1 protein
  • Protein PARM-1 [Precursor]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP1-89781
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-49620
Species: Hu
Applications: IA, ICC/IF, IHC, IHC-P, WB
NBP1-77285
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-75311
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
DLP00
Species: Hu
Applications: ELISA
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-76801
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15275
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46587
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-80930
Species: Ch, Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-76899
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB

Publications for CIPAR-1 Antibody (NBP1-85610)(1)

Reviews for CIPAR-1 Antibody (NBP1-85610) (0)

There are no reviews for CIPAR-1 Antibody (NBP1-85610). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CIPAR-1 Antibody (NBP1-85610) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CIPAR-1 Products

Bioinformatics Tool for CIPAR-1 Antibody (NBP1-85610)

Discover related pathways, diseases and genes to CIPAR-1 Antibody (NBP1-85610). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIPAR-1 Antibody (NBP1-85610)

Discover more about diseases related to CIPAR-1 Antibody (NBP1-85610).
 

Pathways for CIPAR-1 Antibody (NBP1-85610)

View related products by pathway.

Blogs on CIPAR-1

There are no specific blogs for CIPAR-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIPAR-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARM1
Entrez
Uniprot