AE Binding Protein 1/ACLP Antibody (1D2)

Images

 
Immunohistochemistry-Paraffin: AE Binding Protein 1/ACLP Antibody (1D2) [H00000165-M01] - Analysis of monoclonal antibody to AEBP1 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 3 ug/ml.
ELISA: AE Binding Protein 1/ACLP Antibody (1D2) [H00000165-M01] - Detection limit for recombinant GST tagged AEBP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AE Binding Protein 1/ACLP Antibody (1D2) Summary

Immunogen
AEBP1 (NP_001120, 912 a.a. ~ 1013 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTP
Specificity
AEBP1 - AE binding protein 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AEBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 30097586).
Publications
Read Publications using
H00000165-M01 in the following applications:

  • IHC
    2 publications
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AE Binding Protein 1/ACLP Antibody (1D2)

  • ACLP
  • ACLPadipocyte enhancer binding protein 1
  • AE binding protein 1
  • AE-binding protein 1adipocyte enhancer-binding protein 1
  • AEBP1
  • Aortic carboxypeptidase-like protein
  • FLJ33612

Background

The adipocyte enhancer binding protein 1 is a transcriptional repressor with carboxypeptidase (CP) activity. This protein binds to a regulatory sequence, adipocyte enhancer 1 (AE-1), located in the proximal promoter region of the adipose P2 (aP2) gene, which encodes the adipocyte fatty-acid binding protein. It is characterized as a member of the regulatory B-like CP family. This protein seems to be activated by a novel mechanism, whereby the direct binding of DNA enhances its protease activity. Adipocyte-enhancer binding protein 1 may play a role in differentiated vascular smooth muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBL1-09456
Species: Hu
NBP2-48480
Species: Hu
Applications: Flow, IHC, IHC-Fr, Flow-CS
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB847
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, PEP-ELISA, KD
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, KD, KO, PCR
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Pm, Rb
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, Flow-IC
NBP1-31225
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00000165-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for AE Binding Protein 1/ACLP Antibody (H00000165-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(2)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for AE Binding Protein 1/ACLP Antibody (H00000165-M01) (0)

There are no reviews for AE Binding Protein 1/ACLP Antibody (H00000165-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AE Binding Protein 1/ACLP Antibody (H00000165-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AE Binding Protein 1/ACLP Products

Bioinformatics Tool for AE Binding Protein 1/ACLP Antibody (H00000165-M01)

Discover related pathways, diseases and genes to AE Binding Protein 1/ACLP Antibody (H00000165-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AE Binding Protein 1/ACLP Antibody (H00000165-M01)

Discover more about diseases related to AE Binding Protein 1/ACLP Antibody (H00000165-M01).
 

Pathways for AE Binding Protein 1/ACLP Antibody (H00000165-M01)

View related products by pathway.

PTMs for AE Binding Protein 1/ACLP Antibody (H00000165-M01)

Learn more about PTMs related to AE Binding Protein 1/ACLP Antibody (H00000165-M01).

Blogs on AE Binding Protein 1/ACLP

There are no specific blogs for AE Binding Protein 1/ACLP, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AE Binding Protein 1/ACLP Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol AEBP1
Entrez
OMIM
Uniprot