Adrenomedullin/ADM Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Adrenomedullin/ADM Source: E. coli
Amino Acid Sequence: ADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ADM |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17681. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Adrenomedullin/ADM Recombinant Protein Antigen
Background
Adrenomedullin is a member of the calcitonin family of peptides and functions as a vasodilator. Adrenomedullin, a hypotensive peptide, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene related peptide. Human adrenomedullin mRNA was found to be highly expressed in several tissues. Adrenomedullain is secreted from a number of tissues including the adrenal medulla, endothelial and vascular smooth muscle cells. It has been implicated in a number of diseases including cardiovascular and renal disorders, sepsis, inflammation, diabetes and cancer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Publications for Adrenomedullin/ADM Recombinant Protein Antigen (NBP3-17681PEP) (0)
There are no publications for Adrenomedullin/ADM Recombinant Protein Antigen (NBP3-17681PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adrenomedullin/ADM Recombinant Protein Antigen (NBP3-17681PEP) (0)
There are no reviews for Adrenomedullin/ADM Recombinant Protein Antigen (NBP3-17681PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Adrenomedullin/ADM Recombinant Protein Antigen (NBP3-17681PEP) (0)
Additional Adrenomedullin/ADM Products
Research Areas for Adrenomedullin/ADM Recombinant Protein Antigen (NBP3-17681PEP)
Find related products by research area.
|
Blogs on Adrenomedullin/ADM