Home » ADPRHL2 » ADPRHL2 Antibodies » ADPRHL2 Antibody

ADPRHL2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ADPRHL2 Antibody [NBP1-88834] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Western Blot: ADPRHL2 Antibody [NBP1-88834] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunocytochemistry/ Immunofluorescence: ADPRHL2 Antibody [NBP1-88834] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: ADPRHL2 Antibody [NBP1-88834] - Analysis in control (vector only transfected HEK293T lysate) and ADPRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human placenta shows moderate cytoplasmic and nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ADPRHL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
Specificity
Specificity of human ADPRHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADPRHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADPRHL2 Protein (NBP1-88834PEP)
Publications
Read Publication using NBP1-88834.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22433848)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADPRHL2 Antibody

  • [Protein ADP-ribosylarginine] hydrolase-like protein 2
  • ADP-ribosylhydrolase 3
  • ADP-ribosylhydrolase like 2
  • ARH3EC 3.2.1.143
  • FLJ20446
  • poly(ADP-ribose) glycohydrolase ARH3
  • protein ADP-ribosylarginine hydrolase-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PARG Antibody
(OTI6F4)
NBP2-46320
Western Blot: PARG Antibody (OTI6F4) [NBP2-46320] - Analysis of extracts (10ug) from 8 different cell lines by using anti-PARG monoclonal antibody.(1:200
Immunohistochemistry-Paraffin: PARG Antibody (OTI6F4) [NBP2-46320] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Western Blot: PARG Antibody (OTI6F4) [NBP2-46320] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PARG.
Species: Hu
Applications: WB, IHC, IHC-P
ARH Antibody
(4G4-D5)
H00026119-M01
Western Blot: ARH Antibody (4G4-D5) [H00026119-M01] - LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 Analysis of LDLRAP1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: ARH Antibody (4G4-D5) [H00026119-M01] - Analysis of monoclonal antibody to LDLRAP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ARH Antibody (4G4-D5) [H00026119-M01] - Analysis of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. Antibody concentration 2 ug/ml.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
PARP Antibody
(194C1439) - Cleaved
NB100-56599
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
(8 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
Sirtuin 1/SIRT1
Antibody (1F3)
NBP1-51641
Western Blot: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Western blot analysis using SIRT1 mouse mAb against MCF-7 (1), Jurkat (2), Hela (3), HEK293 (4) and A549 (5) cell lysates.
Immunocytochemistry/Immunofluorescence: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - SIRT1 antibody was tested at 1:10 in Ntera2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.
Immunohistochemistry-Paraffin: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues (left) and kidney cancer tissues (right) using SIRT1 mouse mAb with DAB staining.
(5 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl

ADP-ribosylarginine hy ...
H00000141-M04
Western Blot: ADP-ribosylarginine hydrolase Antibody (1F11) [H00000141-M04] - Analysis of ADPRH expression in K-562 (Cat # L009V1).
Immunohistochemistry-Paraffin: ADP-ribosylarginine hydrolase Antibody (1F11) [H00000141-M04] - Analysis of monoclonal antibody to ADPRH on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
ELISA: ADP-ribosylarginine hydrolase Antibody (1F11) [H00000141-M04] - Detection limit for recombinant GST tagged ADPRH is 3 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Sir2.1 Antibody
NB100-1923
Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.
(1 Review)
(2 Publications)
Species: Ce
Applications: WB, IHC, IHC-P, IP
JTB Antibody
NBP1-81746
Western Blot: JTB Antibody [NBP1-81746] - Analysis in control (vector only transfected HEK293T lysate) and JTB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: JTB Antibody [NBP1-81746] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IP, DirELISA
Collagen XI alpha
2 Antibody (473)
NBP2-43728
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Various tissue extracts (50 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with COL11A2 antibody [473] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: COL11A2 protein stained by COL11A2 antibody [473] diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Analysis of A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of human COL11A2-transfected 293T cells (N-terminal fragment of COL11A2 isoform 1) 12 % SDS-PAGE COL11A2 antibody [473] dilution: 1:5000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
TRPM2 Antibody
NB110-81601
Western Blot: TRPM2 Antibody [NB110-81601] - Lane 1: CHO cells untransfected. Lane 2: CHO cell transfected with rat TRPM2 Lane 3: Mouse cortical neurons (cultured) Photo courtesy of Dr. Paco Herson, Oregon Health & Science University.
Immunocytochemistry/Immunofluorescence: TRPM2 Antibody [NB110-81601] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-TRPM2 at 5 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: TRPM2 Antibody [NB110-81601] - Staining of rat hippocampus using NB110-81601. TRPM2 is stained red, GFAP is stained green and nuclei staining is blue. Photo courtesy of Dr. Ji-Zhong Bai, The University of Auckland, New Zealand.
(8 Publications)
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Clusterin/APOJ
[HRP]
DCLU00
(2 Reviews)
(10 Publications)
Species: Hu
ADPRHL1 Antibody
NBP2-39073
Western Blot: ADPRHL1 Antibody [NBP2-39073] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Skeletal muscle tissue
Immunocytochemistry/Immunofluorescence: ADPRHL1 Antibody [NBP2-39073] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody stainign is shown in green.
Immunohistochemistry-Paraffin: ADPRHL1 Antibody [NBP2-39073] - Staining in human heart muscle and prostate tissues using anti-ADPRHL1 antibody. Corresponding ADPRHL1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ADP-Sugar
Pyrophosphatase/NUDT5 ...
NBP1-83131
Western Blot: ADP-Sugar Pyrophosphatase/NUDT5 Antibody [NBP1-83131] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: ADP-Sugar Pyrophosphatase/NUDT5 Antibody [NBP1-83131] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: ADP-Sugar Pyrophosphatase/NUDT5 Antibody [NBP1-83131] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
LDLR Antibody (C7)
NBP1-78159
Western Blot: LDL R Antibody (C7) [NBP1-78159] - Total protein from human HeLa and HepG2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/mL anti-LDL receptor in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
(1 Review)
(20 Publications)
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
MRPL52 Antibody
NBP1-86094
Western Blot: MRPL52 Antibody [NBP1-86094] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-354
Immunocytochemistry/Immunofluorescence: MRPL52 Antibody [NBP1-86094] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: MRPL52 Antibody [NBP1-86094] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
LMP7/PSMB8
Antibody (JB54-32)
NBP2-75554
Western Blot: LMP7/PSMB8 Antibody (JB54-32) [NBP2-75554] - Analysis of Proteasome 20S LMP7 on U937 (1) and A431 (2) cell lysate using anti-Proteasome 20S LMP7 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: LMP7/PSMB8 Antibody (JB54-32) [NBP2-75554] - Staining Proteasome 20S LMP7 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody (JB54-32) [NBP2-75554] - Analysis of paraffin-embedded rat epididymis tissue using anti-Proteasome 20S LMP7 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TORC2 Antibody
NBP2-22356
Western Blot: Torc2 Antibody [NBP2-22356] - Western blot analysis of Torc2 in A. Raji, B. Hek293 and C. Jurkat cell lysates.
Immunocytochemistry/Immunofluorescence: TORC2 Antibody [NBP2-22356] - Torc2 Antibody [NBP2-22356] - Torc2 antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: Torc2 Antibody [NBP2-22356] - IHC staining of Torc2 in mouse thymus.
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
ST8
alpha-2,8-Sialyltrans ...
NBP2-20497
Western Blot: ST8SIA4 Antibody [NBP2-20497] - Sample (30 ug of whole cell lysate) A: Jurkat B: Raji C: THP-1 D: NCI-H929 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: ST8SIA4 Antibody [NBP2-20497] - Immunohistochemical analysis of paraffin-embedded U373 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
FUT9 Antibody
NBP2-57960
Immunocytochemistry/Immunofluorescence: FUT9 Antibody [NBP2-57960] - Staining of human cell line MCF7 shows localization to nucleoplasm, microtubules & cytokinetic bridge. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
LRP-11 Antibody
AF8355
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and PANC‑1 human pancreatic carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Sheep Anti-Human LRP-11 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8355) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for LRP-11 at approximately 60 and 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
LRP-11 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Sheep Anti-Human LRP-11 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8355) at 0.3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC

Publications for ADPRHL2 Antibody (NBP1-88834)(1)


Reviews for ADPRHL2 Antibody (NBP1-88834) (0)

There are no reviews for ADPRHL2 Antibody (NBP1-88834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADPRHL2 Antibody (NBP1-88834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ADPRHL2 Products

Bioinformatics Tool for ADPRHL2 Antibody (NBP1-88834)

Discover related pathways, diseases and genes to ADPRHL2 Antibody (NBP1-88834). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADPRHL2 Antibody (NBP1-88834)

Discover more about diseases related to ADPRHL2 Antibody (NBP1-88834).
 

Pathways for ADPRHL2 Antibody (NBP1-88834)

View related products by pathway.

PTMs for ADPRHL2 Antibody (NBP1-88834)

Learn more about PTMs related to ADPRHL2 Antibody (NBP1-88834).

Blogs on ADPRHL2

There are no specific blogs for ADPRHL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADPRHL2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ADPRHL2
Entrez
Uniprot