ADPRHL2 Antibody

Images

 
Western Blot: ADPRHL2 Antibody [NBP1-88834] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunocytochemistry/ Immunofluorescence: ADPRHL2 Antibody [NBP1-88834] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: ADPRHL2 Antibody [NBP1-88834] - Analysis in control (vector only transfected HEK293T lysate) and ADPRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human placenta shows moderate cytoplasmic and nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADPRHL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADPRHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADPRHL2 Protein (NBP1-88834PEP)
Publications
Read Publication using NBP1-88834.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22433848)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADPRHL2 Antibody

  • [Protein ADP-ribosylarginine] hydrolase-like protein 2
  • ADP-ribosylhydrolase 3
  • ADP-ribosylhydrolase like 2
  • ARH3EC 3.2.1.143
  • FLJ20446
  • poly(ADP-ribose) glycohydrolase ARH3
  • protein ADP-ribosylarginine hydrolase-like protein 2

Background

ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases (see ART1; MIM 601625) transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases, such as ADPRHL2, reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADPRHL2 Antibody (NBP1-88834)(1)

Reviews for ADPRHL2 Antibody (NBP1-88834) (0)

There are no reviews for ADPRHL2 Antibody (NBP1-88834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADPRHL2 Antibody (NBP1-88834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADPRHL2 Products

Research Areas for ADPRHL2 Antibody (NBP1-88834)

Find related products by research area.

Blogs on ADPRHL2

There are no specific blogs for ADPRHL2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADPRHL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADPRHL2
Entrez
Uniprot