ADPRHL2 Antibody

Images

 
Western Blot: ADPRHL2 Antibody [NBP1-88834] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunocytochemistry/ Immunofluorescence: ADPRHL2 Antibody [NBP1-88834] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: ADPRHL2 Antibody [NBP1-88834] - Analysis in control (vector only transfected HEK293T lysate) and ADPRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human placenta shows moderate cytoplasmic and nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADPRHL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
Specificity
Specificity of human ADPRHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADPRHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADPRHL2 Protein (NBP1-88834PEP)
Publications
Read Publication using NBP1-88834.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22433848)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADPRHL2 Antibody

  • [Protein ADP-ribosylarginine] hydrolase-like protein 2
  • ADP-ribosylhydrolase 3
  • ADP-ribosylhydrolase like 2
  • ARH3EC 3.2.1.143
  • FLJ20446
  • poly(ADP-ribose) glycohydrolase ARH3
  • protein ADP-ribosylarginine hydrolase-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46320
Species: Hu
Applications: WB, IHC, IHC-P
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
H00000141-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-39073
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83131
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
NBP1-86094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20497
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57960
Species: Hu
Applications: ICC/IF
AF8355
Species: Hu
Applications: WB, IHC

Publications for ADPRHL2 Antibody (NBP1-88834)(1)

Reviews for ADPRHL2 Antibody (NBP1-88834) (0)

There are no reviews for ADPRHL2 Antibody (NBP1-88834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADPRHL2 Antibody (NBP1-88834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADPRHL2 Products

Bioinformatics Tool for ADPRHL2 Antibody (NBP1-88834)

Discover related pathways, diseases and genes to ADPRHL2 Antibody (NBP1-88834). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADPRHL2 Antibody (NBP1-88834)

Discover more about diseases related to ADPRHL2 Antibody (NBP1-88834).
 

Pathways for ADPRHL2 Antibody (NBP1-88834)

View related products by pathway.

PTMs for ADPRHL2 Antibody (NBP1-88834)

Learn more about PTMs related to ADPRHL2 Antibody (NBP1-88834).

Blogs on ADPRHL2

There are no specific blogs for ADPRHL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADPRHL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADPRHL2
Entrez
Uniprot