ADO Antibody


Western Blot: ADO Antibody [NBP1-88529] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a more
Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88529] - Staining of human testis shows cytoplasmic positivity in leydig cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ADO Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAG
Specificity of human ADO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADO Protein (NBP1-88529PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ADO Antibody

  • 2-aminoethanethiol (cysteamine) dioxygenase
  • 2-aminoethanethiol dioxygenase
  • C10orf22
  • chromosome 10 open reading frame 22
  • cysteamine (2-aminoethanethiol) dioxygenase (ADO)
  • Cysteamine dioxygenase
  • DKFZp564C046
  • EC
  • FLJ14547


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, PLA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for ADO Antibody (NBP1-88529) (0)

There are no publications for ADO Antibody (NBP1-88529).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADO Antibody (NBP1-88529) (0)

There are no reviews for ADO Antibody (NBP1-88529). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADO Antibody (NBP1-88529) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADO Products

Bioinformatics Tool for ADO Antibody (NBP1-88529)

Discover related pathways, diseases and genes to ADO Antibody (NBP1-88529). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADO Antibody (NBP1-88529)

Discover more about diseases related to ADO Antibody (NBP1-88529).

Pathways for ADO Antibody (NBP1-88529)

View related products by pathway.

PTMs for ADO Antibody (NBP1-88529)

Learn more about PTMs related to ADO Antibody (NBP1-88529).

Blogs on ADO

There are no specific blogs for ADO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADO Antibody and receive a gift card or discount.


Gene Symbol ADO