ADO Antibody

Product Discontinued

ADO Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADO
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADO Antibody

• 2-aminoethanethiol (cysteamine) dioxygenase
• 2-aminoethanethiol dioxygenase
• C10orf22
• chromosome 10 open reading frame 22
• cysteamine (2-aminoethanethiol) dioxygenase (ADO)
• Cysteamine dioxygenase
• DKFZp564C046
• EC 1.13.11.19
• FLJ14547

Background

Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase(ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine toform hypotaurine (Dominy et al., 2007 (PubMed 17581819)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADO
• Entrez:
  • 84890(Human)
• Uniprot:
  • Q96SZ5(Human)