ADI1 Antibody

Images

 
Western Blot: ADI1 Antibody [NBP1-89037] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: ADI1 Antibody [NBP1-89037] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: ADI1 Antibody [NBP1-89037] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADI1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ADI1 Protein (NBP1-89037PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADI1 Antibody

  • 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
  • Acireductone dioxygenase (Ni(2+)-requiring)
  • acireductone dioxygenase 1
  • APL1
  • ARDsubmergence induced protein 2
  • EC 1.13.11.53
  • FLJ10913
  • HMFT1638
  • membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1
  • Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1
  • MTCBP1
  • MTCBP-1
  • Ni-ARD
  • SIPLMT1-MMP cytoplasmic tail-binding protein-1
  • Submergence-induced protein 2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NB100-428
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF1436
Species: Mu
Applications: WB
AF2009
Species: Hu
Applications: WB, IHC
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADI1 Antibody (NBP1-89037) (0)

There are no publications for ADI1 Antibody (NBP1-89037).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADI1 Antibody (NBP1-89037) (0)

There are no reviews for ADI1 Antibody (NBP1-89037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADI1 Antibody (NBP1-89037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADI1 Products

Bioinformatics Tool for ADI1 Antibody (NBP1-89037)

Discover related pathways, diseases and genes to ADI1 Antibody (NBP1-89037). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADI1 Antibody (NBP1-89037)

Discover more about diseases related to ADI1 Antibody (NBP1-89037).
 

Pathways for ADI1 Antibody (NBP1-89037)

View related products by pathway.

PTMs for ADI1 Antibody (NBP1-89037)

Learn more about PTMs related to ADI1 Antibody (NBP1-89037).

Blogs on ADI1

There are no specific blogs for ADI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADI1
Entrez
Uniprot