We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Adenylate Kinase 1 Recombinant Protein Antigen

Images

 
There are currently no images for Adenylate Kinase 1 Protein (NBP1-87401PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Adenylate Kinase 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AK1.

Source: E. coli

Amino Acid Sequence: EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87401.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Adenylate Kinase 1 Recombinant Protein Antigen

  • Adenylate Kinase 1
  • adenylate kinase isoenzyme 1
  • AK 1
  • AK1
  • ATP-AMP transphosphorylase 1
  • EC 2.7.4
  • EC 2.7.4.3
  • EC 2.7.4.6
  • Myokinase

Background

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33160
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00005236-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NBP1-31589
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16374
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5075
Species: Hu, Mu, Rt
Applications: WB
NB500-525
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-00827
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-19015
Species: Hu, Mu
Applications: ELISA, ICC/IF,  IHC-P, IP, Simple Western, WB
NBP1-04261
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
DHAPG0
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
2914-HT
Species: Hu
Applications: BA
NBP2-32601
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89111
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85630
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Adenylate Kinase 1 Protein (NBP1-87401PEP) (0)

There are no publications for Adenylate Kinase 1 Protein (NBP1-87401PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Kinase 1 Protein (NBP1-87401PEP) (0)

There are no reviews for Adenylate Kinase 1 Protein (NBP1-87401PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Adenylate Kinase 1 Protein (NBP1-87401PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenylate Kinase 1 Products

Research Areas for Adenylate Kinase 1 Protein (NBP1-87401PEP)

Find related products by research area.

Blogs on Adenylate Kinase 1

There are no specific blogs for Adenylate Kinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Adenylate Kinase 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AK1