Adenylate Kinase 1 Antibody (3A6-1F5)

Images

 
Western Blot: Adenylate Kinase 1 Antibody (3A6-1F5) [H00000203-M06] - Analysis of AK1 expression in transfected 293T cell line by AK1 monoclonal antibody (M06), clone 3A6-1F5. Lane 1: AK1 transfected lysatE (21.6 KDa). ...read more
Immunocytochemistry/ Immunofluorescence: Adenylate Kinase 1 Antibody (3A6-1F5) [H00000203-M06] - Analysis of monoclonal antibody to AK1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: Adenylate Kinase 1 Antibody (3A6-1F5) [H00000203-M06] - Western blot analysis of AK1 over-expressed 293 cell line. Lane 2 cotransfected with AK1 Validated Chimera RNAi Lane 1 non-transfected control. Blot ...read more
Western Blot: Adenylate Kinase 1 Antibody (3A6-1F5) [H00000203-M06] - Analysis of AK1 expression in HeLa (Cat # L013V1).
Immunoprecipitation: Adenylate Kinase 1 Antibody (3A6-1F5) [H00000203-M06] - Analysis of AK1 transfected lysate using anti-AK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AK1 rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, KD
Clone
3A6-1F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Adenylate Kinase 1 Antibody (3A6-1F5) Summary

Immunogen
AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Specificity
AK1 - adenylate kinase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein and cell lysate for WB. It has also been used for IF, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Adenylate Kinase 1 Antibody (3A6-1F5)

  • adenylate kinase 1
  • adenylate kinase isoenzyme 1
  • AK 1
  • ATP-AMP transphosphorylase 1
  • EC 2.7.4
  • EC 2.7.4.3
  • myokinase

Background

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-33160
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005236-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NBP2-66825
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5075
Species: Hu, Mu, Rt
Applications: WB
NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-00827
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19015
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
NBP1-04261
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
2914-HT
Species: Hu
Applications: BA
NBP2-32601
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89111
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for Adenylate Kinase 1 Antibody (H00000203-M06) (0)

There are no publications for Adenylate Kinase 1 Antibody (H00000203-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Kinase 1 Antibody (H00000203-M06) (0)

There are no reviews for Adenylate Kinase 1 Antibody (H00000203-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Adenylate Kinase 1 Antibody (H00000203-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylate Kinase 1 Products

Bioinformatics Tool for Adenylate Kinase 1 Antibody (H00000203-M06)

Discover related pathways, diseases and genes to Adenylate Kinase 1 Antibody (H00000203-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Kinase 1 Antibody (H00000203-M06)

Discover more about diseases related to Adenylate Kinase 1 Antibody (H00000203-M06).
 

Pathways for Adenylate Kinase 1 Antibody (H00000203-M06)

View related products by pathway.

PTMs for Adenylate Kinase 1 Antibody (H00000203-M06)

Learn more about PTMs related to Adenylate Kinase 1 Antibody (H00000203-M06).

Blogs on Adenylate Kinase 1

There are no specific blogs for Adenylate Kinase 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylate Kinase 1 Antibody (3A6-1F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol AK1
Entrez
OMIM
Uniprot