ADAT2 Antibody

Images

 
Western Blot: ADAT2 Antibody [NBP2-82557] - WB Suggested Anti-ADAT2 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAT2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAT2. Peptide sequence: AKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ADAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAT2 Antibody

  • adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
  • DEADC1
  • deaminase domain containing 1
  • Deaminase domain-containing protein 1
  • dJ20N2
  • dJ20N2.1
  • DKFZp686L1118
  • EC 3.5.4
  • EC 3.5.4.-
  • FLJ44213
  • TAD2
  • tRNA-specific adenosine deaminase 2 homolog
  • tRNA-specific adenosine deaminase 2
  • tRNA-specific adenosine-34 deaminase subunit ADAT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-99169
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP2-29865
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-11392
Species: Hu
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-02627
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-89134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82557
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for ADAT2 Antibody (NBP2-82557) (0)

There are no publications for ADAT2 Antibody (NBP2-82557).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAT2 Antibody (NBP2-82557) (0)

There are no reviews for ADAT2 Antibody (NBP2-82557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAT2 Antibody (NBP2-82557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADAT2 Products

Bioinformatics Tool for ADAT2 Antibody (NBP2-82557)

Discover related pathways, diseases and genes to ADAT2 Antibody (NBP2-82557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAT2 Antibody (NBP2-82557)

Discover more about diseases related to ADAT2 Antibody (NBP2-82557).
 

Pathways for ADAT2 Antibody (NBP2-82557)

View related products by pathway.

PTMs for ADAT2 Antibody (NBP2-82557)

Learn more about PTMs related to ADAT2 Antibody (NBP2-82557).

Blogs on ADAT2

There are no specific blogs for ADAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAT2