ADAMTSL-1/Punctin Antibody

Images

 
Western Blot: ADAMTSL-1/Punctin Antibody [NBP2-88762] - Host: Rabbit. Target Name: ADAMTSL1. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTSL-1/Punctin Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAMTSL-1/Punctin. Peptide sequence: EDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTSL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAMTSL-1/Punctin Antibody

  • ADAM-TS related protein 1
  • ADAMTSL1
  • ADAMTSL-1
  • ADAMTS-like 1
  • ADAMTS-like protein 1
  • ADAMTSR1MGC118805
  • C9orf94
  • chromosome 9 open reading frame 94
  • DKFZp686L03130
  • FLJ35283
  • FLJ41032
  • FLJ46891
  • MGC118803
  • MGC40193
  • PUNCTIN
  • Punctin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DTSP10
Species: Hu
Applications: ELISA
NBP1-81426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84619
Species: Hu
Applications: IHC, IHC-P, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-84570
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DY2198-05
Species: Hu
Applications: ELISA
AF3135
Species: Hu
Applications: Neut, Simple Western, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
7268-CT
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-83813
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5117
Species: Hu
Applications: IHC, WB
NBP2-24495
Species: Hu, Pm
Applications: ICC/IF, IHC, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-93502
Species: Hu
Applications: IHC, IHC-P
NBP1-84050
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82689
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-88762
Species: Hu
Applications: WB

Publications for ADAMTSL-1/Punctin Antibody (NBP2-88762) (0)

There are no publications for ADAMTSL-1/Punctin Antibody (NBP2-88762).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTSL-1/Punctin Antibody (NBP2-88762) (0)

There are no reviews for ADAMTSL-1/Punctin Antibody (NBP2-88762). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAMTSL-1/Punctin Antibody (NBP2-88762) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMTSL-1/Punctin Products

Bioinformatics Tool for ADAMTSL-1/Punctin Antibody (NBP2-88762)

Discover related pathways, diseases and genes to ADAMTSL-1/Punctin Antibody (NBP2-88762). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTSL-1/Punctin Antibody (NBP2-88762)

Discover more about diseases related to ADAMTSL-1/Punctin Antibody (NBP2-88762).
 

Pathways for ADAMTSL-1/Punctin Antibody (NBP2-88762)

View related products by pathway.

PTMs for ADAMTSL-1/Punctin Antibody (NBP2-88762)

Learn more about PTMs related to ADAMTSL-1/Punctin Antibody (NBP2-88762).
 

Research Areas for ADAMTSL-1/Punctin Antibody (NBP2-88762)

Find related products by research area.

Blogs on ADAMTSL-1/Punctin

There are no specific blogs for ADAMTSL-1/Punctin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTSL-1/Punctin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTSL1