ADAMTSL-1/Punctin Antibody - BSA Free

Western Blot: ADAMTSL-1/Punctin Antibody [NBP2-88762] - Host: Rabbit. Target Name: ADAMTSL1. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADAMTSL-1/Punctin Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAMTSL-1/Punctin. Peptide sequence: EDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTSL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAMTSL-1/Punctin Antibody - BSA Free

• ADAM-TS related protein 1
• ADAMTSL1
• ADAMTSL-1
• ADAMTS-like 1
• ADAMTS-like protein 1
• ADAMTSR1MGC118805
• C9orf94
• chromosome 9 open reading frame 94
• DKFZp686L03130
• FLJ35283
• FLJ41032
• FLJ46891
• MGC118803
• MGC40193
• PUNCTIN
• Punctin-1

Background

ADAMTSL1 encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTSL1