ADAMTS7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADAMTS7 Antibody [NBP2-55554] - Staining of human cell line U-2 OS shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAMTS7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WDLQTVAVWGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLLSM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTS7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ADAMTS7 Recombinant Protein Antigen (NBP2-55554PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADAMTS7 Antibody - BSA Free

• A disintegrin and metalloproteinase with thrombospondin motifs 7
• a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 7
• ADAM metallopeptidase with thrombospondin type 1 motif, 7
• ADAM-TS 7
• ADAMTS-7
• ADAM-TS7a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein
• COMPase
• DKFZp434H204
• EC 3.4.24
• EC 3.4.24.-
• EC 3.4.24.82

Background

ADAMTS7 - a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTS7