ADAMTS4 Recombinant Protein Antigen

Images

 
There are currently no images for ADAMTS4 Recombinant Protein Antigen (NBP2-57839PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADAMTS4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS4.

Source: E. coli

Amino Acid Sequence: ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAMTS4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57839.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAMTS4 Recombinant Protein Antigen

  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4
  • ADAM metallopeptidase with thrombospondin type 1 motif, 4
  • ADAM-TS 4
  • ADAMTS-2
  • ADAMTS4
  • ADAM-TS4
  • ADAMTS-4
  • ADMP-1
  • ADMP-1EC 3.4.24.82
  • Aggrecanase 1
  • aggrecanase-1
  • EC 3.4.24
  • KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4

Background

ADAMTS4, also known as aggrecanase-1, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan and the brain extracellular matrix proteoglycan brevican. The ADAMTS4 protein contains a signal sequence, a propeptide domain, a catalytic domain, a disintegrin-like motif, and a C-terminal domain with a thrombospondin (TSP) type 1 motif. ADAMTS4 has been implicated in inflammatory joint diseases, and it also may be a factor in the progression of glioma and Alzheimer's disease. ADAMTS4 expression has been documented in normal human brain, cartilage, heart, lung, placenta, muscle, and synovium. ESTs have been isolated from human tissue libraries, including normal brain, lung, pancreas, and skeletal muscle and cancerous breast.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY2198-05
Species: Hu
Applications: ELISA
NBP1-89246
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DM1300
Species: Hu
Applications: ELISA
DMP300
Species: Hu
Applications: ELISA
AF5867
Species: Hu, Mu
Applications: IHC, IP, WB
DTM100
Species: Hu
Applications: ELISA
973-TM
Species: Hu
Applications: InhibAct
M6000B
Species: Mu
Applications: ELISA
NBP1-85432
Species: Hu, Mu
Applications: IHC,  IHC-P, mIF
DMP900
Species: Hu
Applications: ELISA
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
AF4009
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
NBP2-57839PEP
Species: Hu
Applications: AC

Publications for ADAMTS4 Recombinant Protein Antigen (NBP2-57839PEP) (0)

There are no publications for ADAMTS4 Recombinant Protein Antigen (NBP2-57839PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS4 Recombinant Protein Antigen (NBP2-57839PEP) (0)

There are no reviews for ADAMTS4 Recombinant Protein Antigen (NBP2-57839PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAMTS4 Recombinant Protein Antigen (NBP2-57839PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMTS4 Products

Research Areas for ADAMTS4 Recombinant Protein Antigen (NBP2-57839PEP)

Find related products by research area.

Blogs on ADAMTS4

There are no specific blogs for ADAMTS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAMTS4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS4