ADAMDEC1 Antibody (6C4)

Images

 
Immunohistochemistry-Paraffin: ADAMDEC1 Antibody (6C4) [H00027299-M01] - Analysis of monoclonal antibody to ADAMDEC1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Sandwich ELISA: ADAMDEC1 Antibody (6C4) [H00027299-M01] - Detection limit for recombinant GST tagged ADAMDEC1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
6C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADAMDEC1 Antibody (6C4) Summary

Immunogen
ADAMDEC1 (NP_055294, 361 a.a. ~ 471 a.a) partial recombinant protein with GST tag.PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLS QKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTN LCCEALTCKLKPGTDCGGDAPNHTTE
Localization
Secreted
Specificity
ADAMDEC1 - ADAM-like, decysin 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ADAMDEC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publication using H00027299-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADAMDEC1 Antibody (6C4)

  • A disintegrin and metalloproteinase domain-like protein decysin-1
  • ADAM DEC1
  • ADAM-like protein decysin-1
  • ADAM-like, decysin 1
  • decysin
  • disintegrin protease
  • EC 3.4.24.-
  • FLJ79219
  • M12.219

Background

This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-55995
Species: Hu
Applications: ICC/IF
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
930-ADB
Species: Hu
NBP1-84932
Species: Hu
Applications: IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-69364
Species: Hu
Applications: WB, ICC/IF, IHC
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB100-55403
Species: Hu
Applications: WB, PEP-ELISA
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ADAMDEC1 Antibody (H00027299-M01)(1)

Reviews for ADAMDEC1 Antibody (H00027299-M01) (0)

There are no reviews for ADAMDEC1 Antibody (H00027299-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAMDEC1 Antibody (H00027299-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMDEC1 Products

Bioinformatics Tool for ADAMDEC1 Antibody (H00027299-M01)

Discover related pathways, diseases and genes to ADAMDEC1 Antibody (H00027299-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMDEC1 Antibody (H00027299-M01)

Discover more about diseases related to ADAMDEC1 Antibody (H00027299-M01).
 

Pathways for ADAMDEC1 Antibody (H00027299-M01)

View related products by pathway.

PTMs for ADAMDEC1 Antibody (H00027299-M01)

Learn more about PTMs related to ADAMDEC1 Antibody (H00027299-M01).
 

Research Areas for ADAMDEC1 Antibody (H00027299-M01)

Find related products by research area.

Blogs on ADAMDEC1

There are no specific blogs for ADAMDEC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMDEC1 Antibody (6C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMDEC1
Entrez
OMIM
Uniprot