ADAM7 Antibody

Images

 
Immunohistochemistry-Paraffin: ADAM7 Antibody [NBP1-84932] - Staining of human epididymis shows membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGVEGQQLVRPKKLPLIQKRDTGHTHDDDILKTYEEELLYEIKLNRKTLVLHLLRSREFLGSNYSETFYSMKGEAFTRHPQIMDHCFYQGSIVHEYDSAASISTCNGLRGFFRINDQRYLIEPVKYSDEGEHLVFKYNLRVPYGANYS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAM7 Protein (NBP1-84932PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAM7 Antibody

  • a disintegrin and metalloproteinase domain 7
  • ADAM 7
  • ADAM metallopeptidase domain 7
  • disintegrin and metalloproteinase domain-containing protein 7
  • EAPI
  • epididymal apical protein I
  • GP83
  • GP-83
  • Sperm maturation-related glycoprotein GP-83

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55995
Species: Hu
Applications: ICC/IF
H00255926-P01
Species: Hu
930-ADB
Species: Hu
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00011086-M09
Species: Hu
Applications: WB, ELISA
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
H00027299-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88354
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47219
Species: Hu
Applications: WB, PEP-ELISA
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-84932
Species: Hu
Applications: IHC, IHC-P

Publications for ADAM7 Antibody (NBP1-84932) (0)

There are no publications for ADAM7 Antibody (NBP1-84932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM7 Antibody (NBP1-84932) (0)

There are no reviews for ADAM7 Antibody (NBP1-84932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAM7 Antibody (NBP1-84932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM7
Entrez
Uniprot