ADAMDEC1 Antibody (1G2)

Images

 
ELISA: ADAMDEC1 Antibody (1G2) [H00027299-M03] - Detection limit for recombinant GST tagged ADAMDEC1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADAMDEC1 Antibody (1G2) Summary

Immunogen
ADAMDEC1 (NP_055294, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
Specificity
ADAMDEC1 - ADAM-like, decysin 1 (1G2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ADAMDEC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADAMDEC1 Antibody (1G2)

  • A disintegrin and metalloproteinase domain-like protein decysin-1
  • ADAM DEC1
  • ADAMDEC1
  • ADAM-like protein decysin-1
  • ADAM-like, decysin 1
  • Decysin
  • disintegrin protease
  • EC 3.4.24.-
  • FLJ79219
  • M12.219

Background

This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP2-67246
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DMP900
Species: Hu
Applications: ELISA
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
MAB935
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
930-ADB
Species: Hu
Applications: EnzAct
NBP2-75396
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
481-TK/CF
Species: Mu
Applications: BA
936-AD
Species: Hu
Applications: EnzAct
NBP1-69364
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
DCDL40
Species: Hu
Applications: ELISA
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB97861
Species: Hu
Applications: Flow, IHC, IHC-P
NB110-97871
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
DM1300
Species: Hu
Applications: ELISA
H00027299-M03
Species: Hu
Applications: WB, ELISA

Publications for ADAMDEC1 Antibody (H00027299-M03) (0)

There are no publications for ADAMDEC1 Antibody (H00027299-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMDEC1 Antibody (H00027299-M03) (0)

There are no reviews for ADAMDEC1 Antibody (H00027299-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAMDEC1 Antibody (H00027299-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMDEC1 Products

Bioinformatics Tool for ADAMDEC1 Antibody (H00027299-M03)

Discover related pathways, diseases and genes to ADAMDEC1 Antibody (H00027299-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMDEC1 Antibody (H00027299-M03)

Discover more about diseases related to ADAMDEC1 Antibody (H00027299-M03).
 

Pathways for ADAMDEC1 Antibody (H00027299-M03)

View related products by pathway.

PTMs for ADAMDEC1 Antibody (H00027299-M03)

Learn more about PTMs related to ADAMDEC1 Antibody (H00027299-M03).
 

Research Areas for ADAMDEC1 Antibody (H00027299-M03)

Find related products by research area.

Blogs on ADAMDEC1

There are no specific blogs for ADAMDEC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMDEC1 Antibody (1G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMDEC1
Entrez
Uniprot