ADAM22 Recombinant Protein Antigen

Images

 
There are currently no images for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADAM22 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAM22.

Source: E. coli

Amino Acid Sequence: LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAM22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58310.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAM22 Recombinant Protein Antigen

  • ADAM 22
  • ADAM metallopeptidase domain 22
  • ADAM22
  • MDC2
  • metalloproteinase-disintegrin ADAM22-3
  • metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
  • MGC149832

Background

ADAM22 was first described as MDC2 (Metalloproteinase-like disintergin like cysteine rich 2) from analysis of human brain libraries, in search of brain-specific proteins. Two splice variants with different carboxyterminal ends have been described. ADAM22 participates in cell adhesion and spreading by associating with 14-3-3 proteins. It is constitutively produced in normal brain tissue, but decreased or absent in high grade gliomas. Different splice variants of ADAM22 are differentially expressed in areas of the brain. A complex of ADAM22 and LGI1 were shown to regulate synaptic transmission. Complexes of ADAM22, stargazing, and a range of other proteins anchor ADAM22 into the cytoskeleton, and keep ADAM22 in association with the postsynaptic space. ADAM22 does not contain the canonical HExxHxxxxxH zinc metalloproteinase motif, and is not thought to be proteolytically active. ADAM22 is a member of the ADAMS that function in tandem with other ADAMs and which may also have specific individual functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4974
Species: Hu
Applications: IHC
NBP2-42190
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-67246
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92621
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-94660
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-395
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF949
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, IP, KO, WB
DMD00
Species: Hu
Applications: ELISA
936-AD
Species: Hu
Applications: EnzAct
NBP2-30423
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-889
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
AF1376
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
930-ADB
Species: Hu
Applications: EnzAct
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-58310PEP
Species: Hu
Applications: AC

Publications for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP) (0)

There are no publications for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP) (0)

There are no reviews for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAM22 Products

Blogs on ADAM22

There are no specific blogs for ADAM22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAM22 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM22