ADAL Antibody

Images

 
Western Blot: ADAL Antibody [NBP2-55056] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ADAL Antibody [NBP2-55056] - Staining of human cell line HeLa shows localization to microtubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAL Recombinant Protein Antigen (NBP2-55056PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ADAL Antibody

  • adenosine deaminase-like protein
  • adenosine deaminase-like
  • DKFZp313B2137
  • EC 3.5.4
  • EC 3.5.4.-
  • FLJ44620

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-83257
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89238
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
AF1049
Species: Hu
Applications: IHC, WB
NBP2-13876
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85691
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-86851
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00117143-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00000395-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-87203
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-47549
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-46016
Species: Ca, Hu, Pm, Mu, Rt
Applications: IF, WB
H00004502-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP2-32542
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ADAL Antibody (NBP2-55056) (0)

There are no publications for ADAL Antibody (NBP2-55056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAL Antibody (NBP2-55056) (0)

There are no reviews for ADAL Antibody (NBP2-55056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADAL Antibody (NBP2-55056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADAL Products

Bioinformatics Tool for ADAL Antibody (NBP2-55056)

Discover related pathways, diseases and genes to ADAL Antibody (NBP2-55056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAL Antibody (NBP2-55056)

Discover more about diseases related to ADAL Antibody (NBP2-55056).
 

Pathways for ADAL Antibody (NBP2-55056)

View related products by pathway.

PTMs for ADAL Antibody (NBP2-55056)

Learn more about PTMs related to ADAL Antibody (NBP2-55056).

Blogs on ADAL

There are no specific blogs for ADAL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAL