Recombinant Human ACTR1A GST (N-Term) Protein

SDS-Page: Recombinant Human ACTR1A Protein [H00010121-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human ACTR1A GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 279-375 of Human ACTR1A partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: LVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: ACTR1A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACTR1A GST (N-Term) Protein

• Actin-RPV
• alpha-centractin
• ARP1 (actin-related protein 1, yeast) homolog A (centractin alpha)
• ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
• ARP1actin-RPV
• centractin
• Centrosome-associated actin homolog
• CTRN1
• FLJ52695
• FLJ52800
• FLJ55002

Background

ACTR1A - ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ACTR1A