Activin RIIB Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPP |
| Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ACVR2B |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Protein A purified |
Alternate Names for Activin RIIB Antibody
Background
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: Block, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, IHC, Mycoplasma
Publications for Activin RIIB Antibody (NBP2-68638) (0)
There are no publications for Activin RIIB Antibody (NBP2-68638).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Activin RIIB Antibody (NBP2-68638) (0)
There are no reviews for Activin RIIB Antibody (NBP2-68638).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Activin RIIB Antibody (NBP2-68638) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Activin RIIB Products
Research Areas for Activin RIIB Antibody (NBP2-68638)
Find related products by research area.
|
Blogs on Activin RIIB