Recombinant Human Activin RIA/ALK-2/Activin Receptor Type 1 Protein

Order Details


    • Catalog Number
      H00000090-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Activin RIA/ALK-2/Activin Receptor Type 1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human ACVR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF

Protein/Peptide Type
Partial Recombinant Protein
Gene
ACVR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Hepes pH 7.5, 100 mM NaCl, 5 mM DTT, 15 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Activin RIA/ALK-2/Activin Receptor Type 1 Protein

  • activin A receptor, type I
  • Activin RIA
  • ActivinRIA
  • ACTRI
  • ACVR1
  • ACVR1A
  • ACVRLK2
  • ALK2
  • ALK-2
  • FOP
  • SKR1
  • TSRI

Background

ACVR1 - activin A receptor, type I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF3025
Species: Hu
Applications: WB, ICC
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
AF1477
Species: Mu
Applications: WB, IHC, Block
AF340
Species: Hu
Applications: WB, IHC, Block
AF339
Species: Hu
Applications: WB, IHC, Block
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2250
Species: Hu
Applications: WB, IHC
H00000090-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01) (0)

There are no publications for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01) (0)

There are no reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Activin RIA/ALK-2/Activin Receptor Type 1 Products

Bioinformatics Tool for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01)

Discover related pathways, diseases and genes to Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01)

Discover more about diseases related to Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01).
 

Pathways for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01)

View related products by pathway.

PTMs for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01)

Learn more about PTMs related to Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01).
 

Research Areas for Activin RIA/ALK-2/Activin Receptor Type 1 Partial Recombinant Protein (H00000090-Q01)

Find related products by research area.

Blogs on Activin RIA/ALK-2/Activin Receptor Type 1

There are no specific blogs for Activin RIA/ALK-2/Activin Receptor Type 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Activin RIA/ALK-2/Activin Receptor Type 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR1
Entrez