ACSM1 Antibody (NBP1-91645)


Immunocytochemistry/ Immunofluorescence: ACSM1 Antibody [NBP1-91645] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ACSM1 Antibody [NBP1-91645] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ACSM1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Control Peptide
ACSM1 Protein (NBP1-91645PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ACSM1 Antibody

  • acyl-CoA synthetase medium-chain family member 1EC
  • acyl-coenzyme A synthetase ACSM1, mitochondrial
  • BUCS1
  • Butyrate CoA ligase
  • Butyrate--CoA ligase 1
  • butyryl Coenzyme A synthetase 1
  • Butyryl-coenzyme A synthetase 1
  • EC 6.2.1
  • LAE
  • Lipoate-activating enzyme
  • MACS1MGC150532
  • medium-chain acyl-CoA synthetase
  • Middle-chain acyl-CoA synthetase 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ACSM1 Antibody (NBP1-91645) (0)

There are no publications for ACSM1 Antibody (NBP1-91645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSM1 Antibody (NBP1-91645) (0)

There are no reviews for ACSM1 Antibody (NBP1-91645). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACSM1 Antibody (NBP1-91645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACSM1 Products

Related Products by Gene

Bioinformatics Tool for ACSM1 Antibody (NBP1-91645)

Discover related pathways, diseases and genes to ACSM1 Antibody (NBP1-91645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSM1 Antibody (NBP1-91645)

Discover more about diseases related to ACSM1 Antibody (NBP1-91645).

Pathways for ACSM1 Antibody (NBP1-91645)

View related products by pathway.

PTMs for ACSM1 Antibody (NBP1-91645)

Learn more about PTMs related to ACSM1 Antibody (NBP1-91645).

Blogs on ACSM1

There are no specific blogs for ACSM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACSM1 Antibody and receive a gift card or discount.


Gene Symbol ACSM1