ACSL1 Recombinant Protein Antigen

Images

 
There are currently no images for ACSL1 Protein (NBP1-89270PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACSL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACSL1.

Source: E. coli

Amino Acid Sequence: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACSL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89270.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACSL1 Recombinant Protein Antigen

  • ACS1LACS 2
  • Acyl-CoA synthetase 1
  • acyl-CoA synthetase long-chain family member 1
  • EC 6.2.1
  • FACL1EC 6.2.1.3
  • fatty-acid-Coenzyme A ligase, long-chain 1
  • LACS 1
  • LACSlong-chain 2
  • lignoceroyl-CoA synthase
  • Long-chain acyl-CoA synthetase 1
  • Long-chain acyl-CoA synthetase 2
  • Long-chain fatty acid-CoA ligase 2
  • long-chain fatty-acid-coenzyme A ligase 1
  • long-chain-fatty-acid--CoA ligase 1
  • Palmitoyl-CoA ligase 1
  • Palmitoyl-CoA ligase 2
  • paltimoyl-CoA ligase 1

Background

Long-chain-fatty-acid--CoA ligase 1, or ACSL1, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in lipid biosynthesis and fatty acid degradation. Like other isozymes of this family, ALCS1 converts free long-chain fatty acids into fatty acyl-CoA esters. ACSL1 preferentially uses palmitoleate, oleate and linoleate, and altered expression of ACSL1 is thought to increase accumulation of triglycerides in the liver.

ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051703-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15253
Species: Mu, Rt
Applications: WB
NBP1-92089
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-15252
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB6898
Species: Hu, Mu
Applications: WB
NBP2-81909
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-05516
Species: Hu
Applications: IHC,  IHC-P
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-89270PEP
Species: Hu
Applications: AC

Publications for ACSL1 Protein (NBP1-89270PEP) (0)

There are no publications for ACSL1 Protein (NBP1-89270PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL1 Protein (NBP1-89270PEP) (0)

There are no reviews for ACSL1 Protein (NBP1-89270PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACSL1 Protein (NBP1-89270PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACSL1 Products

Array NBP1-89270PEP

Research Areas for ACSL1 Protein (NBP1-89270PEP)

Find related products by research area.

Blogs on ACSL1.

Immune Cell Metabolic Flux Influences Type I Diabetes
By Hunter MartinezWhat is Immunometabolism?It is well established that abnormal metabolic environments can be a risk factor for disease development. One characteristic example is the role of dyslipidemia (high lev...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACSL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL1