ACSL1 Antibody (3G4)

Images

 
Sandwich ELISA: ACSL1 Antibody (3G4) [H00002180-M02] - Detection limit for recombinant GST tagged ACSL1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACSL1 Antibody (3G4) Summary

Immunogen
ACSL1 (NP_001986, 48 a.a. - 145 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Specificity
ACSL1 (3G4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACSL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00002180-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACSL1 Antibody (3G4)

  • ACS1LACS 2
  • Acyl-CoA synthetase 1
  • acyl-CoA synthetase long-chain family member 1
  • EC 6.2.1
  • FACL1EC 6.2.1.3
  • fatty-acid-Coenzyme A ligase, long-chain 1
  • LACS 1
  • LACSlong-chain 2
  • lignoceroyl-CoA synthase
  • Long-chain acyl-CoA synthetase 1
  • Long-chain acyl-CoA synthetase 2
  • Long-chain fatty acid-CoA ligase 2
  • long-chain fatty-acid-coenzyme A ligase 1
  • long-chain-fatty-acid--CoA ligase 1
  • Palmitoyl-CoA ligase 1
  • Palmitoyl-CoA ligase 2
  • paltimoyl-CoA ligase 1

Background

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00376497-D01P
Species: Hu, Mu
Applications: WB, ELISA
H00002181-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-37738
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB110-37253
Species: Hu, Mu, Rt
Applications: WB

Publications for ACSL1 Antibody (H00002180-M02)(2)

Reviews for ACSL1 Antibody (H00002180-M02) (0)

There are no reviews for ACSL1 Antibody (H00002180-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL1 Antibody (H00002180-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSL1 Products

Bioinformatics Tool for ACSL1 Antibody (H00002180-M02)

Discover related pathways, diseases and genes to ACSL1 Antibody (H00002180-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL1 Antibody (H00002180-M02)

Discover more about diseases related to ACSL1 Antibody (H00002180-M02).
 

Pathways for ACSL1 Antibody (H00002180-M02)

View related products by pathway.

PTMs for ACSL1 Antibody (H00002180-M02)

Learn more about PTMs related to ACSL1 Antibody (H00002180-M02).
 

Research Areas for ACSL1 Antibody (H00002180-M02)

Find related products by research area.

Blogs on ACSL1

There are no specific blogs for ACSL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSL1 Antibody (3G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL1
Entrez
OMIM
Uniprot