ACRBP Antibody - BSA Free

Western Blot: ACRBP Antibody [NBP2-84387] - Host: Rabbit. Target Name: ACRBP. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: ACRBP Antibody [NBP2-84387] - Host: Rabbit. Target Name: ACRBP. Sample Tissue: Human PANC1 Whole Cell. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ACRBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACRBP Antibody - BSA Free (NBP2-84387) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACRBP. Peptide sequence: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACRBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ACRBP Antibody - BSA Free

• acrosin binding protein
• acrosin-binding protein
• Cancer/testis antigen 23
• Cancer/testis antigen OY-TES-1
• CT23FLJ51160
• OY-TES-1
• proacrosin binding protein sp32
• Proacrosin-binding protein sp32
• SP32

Background

ACRBP is encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACRBP