ACP2 Antibody

Images

 
Western Blot: ACP2 Antibody [NBP1-62491] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Immunohistochemistry-Paraffin: ACP2 Antibody [NBP1-62491] - Human Liver tissue, 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACP2(acid phosphatase 2, lysosomal) The peptide sequence was selected from the middle region of ACP2 (NP_001601). Peptide sequence VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACP2 and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACP2 Antibody

  • acid phosphatase 2, lysosomal
  • EC 3.1.3.2
  • LAP
  • lysosomal acid phosphatase

Background

ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene.Lysosomal acid phosphatase is comprised of two subunits, alpha and beta, and is chemically and genetically distinct from red cell acid phosphatase. Lysosomal acid phosphatase 2 is a member of a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Acid phosphatase deficiency is caused by mutations in the ACP2 (beta subunit) and ACP3 (alpha subunit) genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-65899
Species: Hu
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-65749
Species: Hu
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-2320
Species: Hu
Applications: IP (-), WB, IP
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-62491
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ACP2 Antibody (NBP1-62491) (0)

There are no publications for ACP2 Antibody (NBP1-62491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACP2 Antibody (NBP1-62491) (0)

There are no reviews for ACP2 Antibody (NBP1-62491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACP2 Antibody (NBP1-62491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ACP2 Antibody (NBP1-62491)

Discover related pathways, diseases and genes to ACP2 Antibody (NBP1-62491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACP2 Antibody (NBP1-62491)

Discover more about diseases related to ACP2 Antibody (NBP1-62491).
 

Pathways for ACP2 Antibody (NBP1-62491)

View related products by pathway.

PTMs for ACP2 Antibody (NBP1-62491)

Learn more about PTMs related to ACP2 Antibody (NBP1-62491).
 

Research Areas for ACP2 Antibody (NBP1-62491)

Find related products by research area.

Blogs on ACP2

There are no specific blogs for ACP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACP2
Entrez
Uniprot