Recombinant Human ACOX2 Protein

Images

 
SDS-Page: Recombinant Human ACOX2 Protein [H00008309-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human ACOX2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 582-681 of Human ACOX2

Source: Wheat Germ

Amino Acid Sequence: HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACOX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACOX2 Protein

  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase
  • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase
  • 3-alpha
  • 7-alpha
  • acyl-CoA oxidase 2, branched chain
  • acyl-Coenzyme A oxidase 2, branched chain
  • BCOX
  • BRCACOXTHCA-CoA oxidase
  • BRCOX
  • EC 1.17.99.3
  • peroxisomal acyl-coenzyme A oxidase 2,3-alpha
  • peroxisomal branched chain acyl-CoA oxidase
  • THCCox
  • Trihydroxycoprostanoyl-CoA oxidase

Background

ACOX2 - acyl-Coenzyme A oxidase 2, branched chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85901
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
MAB9120
Species: Hu
Applications: ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-59576
Species: Hu, Mu
Applications: WB, IHC
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP2-29939
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-16081
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACOX2 Partial Recombinant Protein (H00008309-Q01) (0)

There are no publications for ACOX2 Partial Recombinant Protein (H00008309-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOX2 Partial Recombinant Protein (H00008309-Q01) (0)

There are no reviews for ACOX2 Partial Recombinant Protein (H00008309-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOX2 Partial Recombinant Protein (H00008309-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ACOX2 Partial Recombinant Protein (H00008309-Q01)

Discover related pathways, diseases and genes to ACOX2 Partial Recombinant Protein (H00008309-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOX2 Partial Recombinant Protein (H00008309-Q01)

Discover more about diseases related to ACOX2 Partial Recombinant Protein (H00008309-Q01).
 

Pathways for ACOX2 Partial Recombinant Protein (H00008309-Q01)

View related products by pathway.

PTMs for ACOX2 Partial Recombinant Protein (H00008309-Q01)

Learn more about PTMs related to ACOX2 Partial Recombinant Protein (H00008309-Q01).

Blogs on ACOX2

There are no specific blogs for ACOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ACOX2 Antibody
NBP2-57292

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ACOX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOX2