ACOT8 Antibody (3F1)

Images

 
Western Blot: ACOT8 Antibody (3F1) [H00010005-M03] - Analysis of ACOT8 expression in A-431 (Cat # L015V1).
Western Blot: ACOT8 Antibody (3F1) [H00010005-M03] - Analysis of ACOT8 expression in transfected 293T cell line by ACOT8 monoclonal antibody (M03), clone 3F1. Lane 1: ACOT8 transfected lysate (Predicted MW: 35.9 KDa). ...read more
Sandwich ELISA: ACOT8 Antibody (3F1) [H00010005-M03] - Detection limit for recombinant GST tagged ACOT8 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACOT8 Antibody (3F1) Summary

Immunogen
ACOT8 (NP_005460.2, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYI
Specificity
Reacts with acyl-CoA thioesterase 8.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACOT8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACOT8 Antibody (3F1)

  • ACTEIII
  • acyl-CoA thioesterase 8HNAACTE
  • Choloyl-coenzyme A thioesterase
  • EC 3.1.2.27
  • hACTEIII
  • HIV-Nef-associated acyl-CoA thioesterase
  • hTEcholoyl-CoA hydrolase
  • long-chain fatty-acyl-CoA hydrolase
  • palmitoyl-CoA hydrolase
  • peroxisomal acyl-CoA thioesterase 1
  • peroxisomal acyl-CoA thioesterase
  • Peroxisomal acyl-coenzyme A thioester hydrolase 1
  • Peroxisomal long-chain acyl-CoA thioesterase 1
  • PTE-1
  • PTE1HIV-Nef associated acyl-CoA thioesterase
  • PTE2
  • PTE-2hACTE-IIIacyl-coenzyme A thioesterase 8
  • Thioesterase II
  • thioesterase III

Background

The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-89278
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-24608
Species: Hu, Mu, Pm, Rt
Applications: WB
NBP2-62632
Species: Hu
Applications: IHC, IHC-P, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP3-12713
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-58936
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85691
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-04752
Species: Hu, Mu, Rt
Applications: WB
H00010005-M03
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for ACOT8 Antibody (H00010005-M03) (0)

There are no publications for ACOT8 Antibody (H00010005-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT8 Antibody (H00010005-M03) (0)

There are no reviews for ACOT8 Antibody (H00010005-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOT8 Antibody (H00010005-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACOT8 Products

Bioinformatics Tool for ACOT8 Antibody (H00010005-M03)

Discover related pathways, diseases and genes to ACOT8 Antibody (H00010005-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOT8 Antibody (H00010005-M03)

Discover more about diseases related to ACOT8 Antibody (H00010005-M03).
 

Pathways for ACOT8 Antibody (H00010005-M03)

View related products by pathway.

PTMs for ACOT8 Antibody (H00010005-M03)

Learn more about PTMs related to ACOT8 Antibody (H00010005-M03).

Blogs on ACOT8

There are no specific blogs for ACOT8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOT8 Antibody (3F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOT8
Entrez
Uniprot